PDP1/PPAPDC2 Antibody - BSA Free

Western Blot: PDP1/PPAPDC2 Antibody [NBP1-60021] - Human Heart lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PDP1/PPAPDC2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to PPAPDC2(phosphatidic acid phosphatase type 2 domain containing 2) The peptide sequence was selected from the N terminal of PPAPDC2. Peptide sequence MPSPRRSMEGRPLGVSASSSSSSPGSPAHGGGGGGSRFEFQSLLSSRATA. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PLPP6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 32 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PDP1/PPAPDC2 Antibody - BSA Free

• bA6J24.6
• EC 3.1.3
• EC 3.1.3.-
• FLJ46512
• FLJ90191
• MGC15483
• PDP1
• phosphatidic acid phosphatase type 2 domain containing 2
• Phosphatidic acid phosphatase type 2 domain-containing protein 2
• polyisoprenoid diphosphate phosphatase type 1
• PPAP2 domain-containing protein 2
• presqualene diphosphate phosphatase
• PSDP

Background

PPAPDC2 is the phosphatase that dephosphorylates presqualene diphosphate (PSDP) into presqualene monophosphate (PSMP), suggesting that it may be indirectly involved in innate immunity. PSDP is a bioactive lipid that rapidly remodels to presqualene monophosphate PSMP upon cell activation. PPAPDC2 displays diphosphate phosphatase activity with a substrate preference for PSDP > FDP > phosphatidic acid.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PLPP6
• Uniprot:
  • Q8IY26(Human)