PDP1/PPAPDC2 Antibody


Western Blot: PDP1/PPAPDC2 Antibody [NBP1-60021] - Human Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

PDP1/PPAPDC2 Antibody Summary

Synthetic peptides corresponding to PPAPDC2(phosphatidic acid phosphatase type 2 domain containing 2) The peptide sequence was selected from the N terminal of PPAPDC2. Peptide sequence MPSPRRSMEGRPLGVSASSSSSSPGSPAHGGGGGGSRFEFQSLLSSRATA.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against PPAPDC2 and was validated on Western blot.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PDP1/PPAPDC2 Antibody

  • bA6J24.6
  • EC 3.1.3
  • EC 3.1.3.-
  • FLJ46512
  • FLJ90191
  • MGC15483
  • PDP1
  • phosphatidic acid phosphatase type 2 domain containing 2
  • Phosphatidic acid phosphatase type 2 domain-containing protein 2
  • polyisoprenoid diphosphate phosphatase type 1
  • PPAP2 domain-containing protein 2
  • presqualene diphosphate phosphatase
  • PSDP


PPAPDC2 is the phosphatase that dephosphorylates presqualene diphosphate (PSDP) into presqualene monophosphate (PSMP), suggesting that it may be indirectly involved in innate immunity. PSDP is a bioactive lipid that rapidly remodels to presqualene monophosphate PSMP upon cell activation. PPAPDC2 displays diphosphate phosphatase activity with a substrate preference for PSDP > FDP > phosphatidic acid.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ChIP
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Ca
Applications: WB, Flow
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: IHC, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for PDP1/PPAPDC2 Antibody (NBP1-60021) (0)

There are no publications for PDP1/PPAPDC2 Antibody (NBP1-60021).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDP1/PPAPDC2 Antibody (NBP1-60021) (0)

There are no reviews for PDP1/PPAPDC2 Antibody (NBP1-60021). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDP1/PPAPDC2 Antibody (NBP1-60021) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PDP1/PPAPDC2 Products

Bioinformatics Tool for PDP1/PPAPDC2 Antibody (NBP1-60021)

Discover related pathways, diseases and genes to PDP1/PPAPDC2 Antibody (NBP1-60021). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDP1/PPAPDC2 Antibody (NBP1-60021)

Discover more about diseases related to PDP1/PPAPDC2 Antibody (NBP1-60021).

Pathways for PDP1/PPAPDC2 Antibody (NBP1-60021)

View related products by pathway.

PTMs for PDP1/PPAPDC2 Antibody (NBP1-60021)

Learn more about PTMs related to PDP1/PPAPDC2 Antibody (NBP1-60021).

Blogs on PDP1/PPAPDC2

There are no specific blogs for PDP1/PPAPDC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PDP1/PPAPDC2 Antibody and receive a gift card or discount.


Gene Symbol PPAPDC2