PDK4 Antibody - Azide and BSA Free

Western Blot: PDK4 Antibody [NBP2-95194] - Western blot analysis of extracts of various cell lines, using PDK4 antibody (NBP2-95194) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunohistochemistry-Paraffin: PDK4 Antibody [NBP2-95194] - Immunohistochemistry of paraffin-embedded human placenta using PDK4 Rabbit pAb (NBP2-95194) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: PDK4 Antibody [NBP2-95194] - Immunohistochemistry of paraffin-embedded rat heart using PDK4 Rabbit pAb (NBP2-95194) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PDK4 Antibody - Azide and BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 312-411 of human PDK4 (NP_002603.1). STAPTPVMDNSRNAPLAGFGYGLPISRLYAKYFQGDLNLYSLSGYGTDAIIYLKALSSESIEKLPVFNKSAFKHYQMSSEADDWCIPSREPKNLAKEVAM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PDK4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 46 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for PDK4 Antibody - Azide and BSA Free

• [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 4, mitochondrial
• EC 2.7.11
• EC 2.7.11.2
• FLJ40832
• Pyruvate dehydrogenase kinase isoform 4
• pyruvate dehydrogenase kinase, isoenzyme 4
• pyruvate dehydrogenase kinase, isozyme 4
• pyruvate dehydrogenase, lipoamide, kinase isozyme 4, mitochondrial

Background

Pyruvate dehydrogenase kinase isoform 4 (PDK4) is a component of the mitochondrial multienzyme complex (PHD) which is responsible for carbohydrate fuel regulation. PDK1 inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism.

PDK4 antibodies are useful tools for glucose metabolism research and mitochondiral metabolism studies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

FAQs for PDK4 Antibody (NBP2-95194). (Showing 1 - 1 of 1 FAQ).

1. Which PDK4 antibody do you recommend for immunoblot? I'm working with human cell lines.
   • NBP1-07047 and NBP1-07049 are our best selling PDK4 antibodies that will meet your mentioned criteria i.e. Immunoblot/Western Blot in Human samples. However, all of our products are 100% guaranteed and you may find a complete list of PDK4 antibodies by searching PDK4 on our website and narrowing your results using the filters on the left-hand side of the screen.

Bioinformatics

• Gene Symbol: PDK4