PDK4 Antibody - BSA Free

Immunohistochemistry-Paraffin: PDK4 Antibody [NBP2-49235] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PDK4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QSLMDLVEFHEKSPDDQKALSDFVDTLIKVRNRHHNVVPTMAQG
• Predicted Species: Mouse (93%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PDK4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PDK4 Recombinant Protein Antigen (NBP2-49235PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PDK4 Antibody - BSA Free

• [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 4, mitochondrial
• EC 2.7.11
• EC 2.7.11.2
• FLJ40832
• Pyruvate dehydrogenase kinase isoform 4
• pyruvate dehydrogenase kinase, isoenzyme 4
• pyruvate dehydrogenase kinase, isozyme 4
• pyruvate dehydrogenase, lipoamide, kinase isozyme 4, mitochondrial

Background

Pyruvate dehydrogenase kinase isoform 4 (PDK4) is a component of the mitochondrial multienzyme complex (PHD) which is responsible for carbohydrate fuel regulation. PDK1 inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism.

PDK4 antibodies are useful tools for glucose metabolism research and mitochondiral metabolism studies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for PDK4 Antibody (NBP2-49235). (Showing 1 - 1 of 1 FAQ).

1. Which PDK4 antibody do you recommend for immunoblot? I'm working with human cell lines.
   • NBP1-07047 and NBP1-07049 are our best selling PDK4 antibodies that will meet your mentioned criteria i.e. Immunoblot/Western Blot in Human samples. However, all of our products are 100% guaranteed and you may find a complete list of PDK4 antibodies by searching PDK4 on our website and narrowing your results using the filters on the left-hand side of the screen.

Bioinformatics

• Gene Symbol: PDK4