PDIR Antibody - BSA Free

Western Blot: PDIR Antibody [NBP1-92252] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Immunohistochemistry: PDIR Antibody [NBP1-92252] - Staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic and decidual cells.

Immunohistochemistry: PDIR Antibody [NBP1-92252] - Staining of human testis shows moderate to strong granular cytoplasmic positivity Leydig cells and in cells in seminiferous ducts.

Immunohistochemistry: PDIR Antibody [NBP1-92252] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry: PDIR Antibody [NBP1-92252] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.

Staining of human liver, placenta, skeletal muscle and testis using NBP1-92252 (A) shows similar protein distribution across tissues to independent antibody NBP1-92250 (B).

Analysis in human placenta and skeletal muscle tissues using NBP1-92252 antibody. Corresponding PDIA5 RNA-seq data are presented for the same tissues.

Staining of human cell line U-251 MG shows localization to nucleoplasm, nucleoli fibrillar center & the Golgi apparatus.

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PDIR Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PDIR Antibody - BSA Free (NBP1-92252) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-PDIR Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VTFKSIVAFLKDPKGPPLWEEDPGAKDVVHLDSEKDFRRLLKKEEKPLLIMFYAPWCSMCKRMMPHFQKAATQLRGHAVLAGMNVYSSEFE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PDIA5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1.0 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PDIR Protein (NBP1-92252PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PDIR Antibody - BSA Free

• FLJ30401
• PDIREC 5.3.4.1
• protein disulfide isomerase family A, member 5
• protein disulfide isomerase-associated 5
• Protein disulfide isomerase-related protein
• protein disulfide-isomerase A5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PDIR Antibody (NBP1-92252)(1)

Publication using NBP1-92252

• Chamberlain N, Ruban M, Mark Z et al. Protein Disulfide Isomerase A3 Regulates Influenza Neuraminidase Activity and Influenza Burden in the Lung International Journal of Molecular Sciences 2022-01-19 [PMID: 35162999] (WB, Mouse)

Bioinformatics

• Gene Symbol: PDIA5