PDIR Antibody

Images

 
Western Blot: PDIR Antibody [NBP1-92252] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: PDIR Antibody [NBP1-92252] - Staining of human cell line U-251 MG shows positivity in nucleoli, nucleus but not nucleoli and golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PDIR Antibody [NBP1-92252] - Staining of human testis shows moderate to strong granular cytoplasmic positivity Leydig cells and in cells in seminiferous ducts.
Western Blot: PDIR Antibody [NBP1-92252] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: PDIR Antibody [NBP1-92252] - Staining of human placenta using Anti-PDIA5 antibody.
Immunohistochemistry-Paraffin: PDIR Antibody [NBP1-92252] - Staining of human testis using Anti-PDIA5 antibody.
Immunohistochemistry-Paraffin: PDIR Antibody [NBP1-92252] - Staining of human liver using Anti-PDIA5 antibody.
Immunohistochemistry-Paraffin: PDIR Antibody [NBP1-92252] - Staining of human lymph node using Anti-PDIA5 antibody.
Immunohistochemistry-Paraffin: PDIR Antibody [NBP1-92252] - Staining of human testis.
Independent Antibodies: Immunohistochemistry-Paraffin: PDIR Antibody [NBP1-92252] - Staining of human liver, placenta, skeletal muscle and testis using Anti-PDIA5 antibody NBP1-92252 (A) shows similar protein ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: PDIR Antibody [NBP1-92252] - Analysis in human placenta and skeletal muscle tissues using NBP1-92252 antibody. Corresponding PDIA5 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: PDIR Antibody [NBP1-92252] - Staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic and decidual cells.
Immunohistochemistry-Paraffin: PDIR Antibody [NBP1-92252] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: PDIR Antibody [NBP1-92252] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PDIR Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VTFKSIVAFLKDPKGPPLWEEDPGAKDVVHLDSEKDFRRLLKKEEKPLLIMFYAPWCSMCKRMMPHFQKAATQLRGHAVLAGMNVYSSEFE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDIA5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PDIR Protein (NBP1-92252PEP)
Publications
Read Publication using
NBP1-92252 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PDIR Antibody

  • FLJ30401
  • PDIREC 5.3.4.1
  • protein disulfide isomerase family A, member 5
  • protein disulfide isomerase-associated 5
  • Protein disulfide isomerase-related protein
  • protein disulfide-isomerase A5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89394
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38213
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB300-517
Species: Bv, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
NBP1-84796
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-37761
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85965
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-71702
Species: Ch, Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NB100-1921
Species: Bv, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-76846
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB3446
Species: Hu
Applications: WB
AF1543
Species: Hu
Applications: IHC, WB
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-52983
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-49532
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NB100-695
Species: Fi, Hu, Mu, Rt
Applications: ELISA, IHC, KD, WB
NB100-2525
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NB110-61646
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB

Publications for PDIR Antibody (NBP1-92252)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for PDIR Antibody (NBP1-92252) (0)

There are no reviews for PDIR Antibody (NBP1-92252). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDIR Antibody (NBP1-92252) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDIR Products

Bioinformatics Tool for PDIR Antibody (NBP1-92252)

Discover related pathways, diseases and genes to PDIR Antibody (NBP1-92252). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDIR Antibody (NBP1-92252)

Discover more about diseases related to PDIR Antibody (NBP1-92252).
 

Pathways for PDIR Antibody (NBP1-92252)

View related products by pathway.

PTMs for PDIR Antibody (NBP1-92252)

Learn more about PTMs related to PDIR Antibody (NBP1-92252).
 

Research Areas for PDIR Antibody (NBP1-92252)

Find related products by research area.

Blogs on PDIR

There are no specific blogs for PDIR, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDIR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDIA5