PDGF-B Antibody

Images

 
Western Blot: PDGF-B Antibody [NBP1-58279] - Antibody Titration: 1 ug/ml Human liver.
Immunohistochemistry: PDGF-B Antibody [NBP1-58279] - Human Adult liver Observed Staining: Cytoplasmic Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody ...read more
Western Blot: PDGF-B Antibody [NBP1-58279] - 293T cell lysate, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry-Paraffin: PDGF-B Antibody [NBP1-58279] - Human Uterus Tissue, 4-8ug/ml.
Knockdown Validated: PDGF-B Antibody [NBP1-58279] - Lanes 1-4 and 7-10 are control and lanes 5, 6, 11 and 12 were PDGF-B knockdown. Knockdown was performed with PDGF-B human siRNA using 20 nM concentration using ...read more
Immunocytochemistry/ Immunofluorescence: Rabbit Polyclonal PDGF-B Antibody [NBP1-58279] - Human primary brain microvascular endothelial cells stained for PDGF-BB (NBP1-58279), red and HSPG (NBP1-05170), green and ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

PDGF-B Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to PDGFB(platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog)) The peptide sequence was selected from the N terminal of PDGFB. Peptide sequence NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD The peptide sequence for this immunogen was taken from within the described region.
Specificity
This product is specific to Subunit or Isoform: B.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDGFB
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence Validated for Immunocytochemistry/Immunofluorescence from a verified customer review.
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Knockdown Validated
  • Western Blot 1.0 ug/ml
Application Notes
PDGF-B Antibody validated for Knockdown from a verified customer review.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 2 Reviews rated 5
using
NBP1-58279 in the following applications:

Publications
Read Publications using
NBP1-58279 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for PDGF-B Antibody

  • B chain
  • Becaplermin
  • C-Sis
  • FLJ12858
  • IBGC5
  • PDGF subunit B
  • PDGF2
  • PDGF-2
  • PDGFB
  • PDGF-B
  • platelet-derived growth factor 2
  • platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis)oncogene homolog)
  • Platelet-derived growth factor beta polypeptide
  • platelet-derived growth factor subunit B
  • platelet-derived growth factor, B chain
  • Platelet-derived growth factor, beta polypeptide (oncogene SIS)
  • Proto-oncogene c-Sis
  • SIS
  • SSV

Background

PDGFB is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a motif of eight cysteines. PDGFB can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 7, at sites where this gene and that for COL1A1 are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans resulting from unregulated expression of growth factor.The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a motif of eight cysteines. This gene product can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 7, at sites where this gene and that for COL1A1 are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans resulting from unregulated expression of growth factor. Two splice variants have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PDGF-B Antibody (NBP1-58279)(2)

Reviews for PDGF-B Antibody (NBP1-58279) (2) 52

Average Rating: 5
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Human.

Reviews using NBP1-58279:
Filter by Applications
ICC
(1)
KD
(1)
All Applications
Filter by Species
Human
(2)
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry PDGF-B NBP1-58279
Enlarge
5
reviewed by:
KARTHIKEYAN THIRUGNANAM
ICC Human 01/23/2024
View

Summary

ApplicationImmunocytochemistry
Sample TestedBrain microvascular endothelial cells,HUman brain microvascular endothelial cells
SpeciesHuman
LotQC56462-160608

Comments

Comments***Novus Innovators Program - new species or application used on a primary antibody.***
Knockdown Validated PDGF-B NBP1-58279
Enlarge
5
reviewed by:
Verified Customer
KD Human 03/22/2023
View

Summary

ApplicationKnockdown Validated
Sample Tested20 ug whole cell lysate
SpeciesHuman
LotQC56462-160608

Comments

Comments***Novus Innovators Program - new species or application used on a primary antibody.***
Knockdown was performed with PDGF-B human siRNA using 20 nM concentration using transfection reagent. Primary antibody dilution - 1:500.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PDGF-B Antibody (NBP1-58279) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDGF-B Products

Research Areas for PDGF-B Antibody (NBP1-58279)

Find related products by research area.

Blogs on PDGF-B

There are no specific blogs for PDGF-B, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
2
4
0
3
0
2
0
1
0

KARTHIKEYAN THIRUGNANAM
01/23/2024
Application: ICC
Species: Human

Verified Customer
03/22/2023
Application: KD
Species: Human

Bioinformatics

Gene Symbol PDGFB
Uniprot