PD-1 Antibody (CL3624)

Images

 
Western Blot: PD-1 Antibody (CL3624) [NBP2-61625] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry: PD-1 Antibody (CL3624) [NBP2-61625] - Staining of human liver shows absence of immunoreactivity (negative control).
Immunohistochemistry: PD-1 Antibody (CL3624) [NBP2-61625] - Staining of human tonsil shows strong immunoreactivity in a subset of lymphoid cells, mainly in the reaction centrum.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clone
CL3624
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PD-1 Antibody (CL3624) Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: WFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAIS
Epitope
CRFRVTQLPNGRDFH
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
PDCD1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 1 ug/ml
Application Notes
IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
PD-1 Recombinant Protein Antigen (NBP2-61625PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for PD-1 Antibody (CL3624)

  • CD279 antigen
  • CD279
  • hPD-1
  • PD1
  • PD-1
  • PD1hPD-l
  • PDCD1
  • programmed cell death 1
  • programmed cell death protein 1
  • Protein PD-1
  • SLEB2

Background

PD1 is an inhibitory cell membrane surface receptor from the immunoglobulin superfamily. Involved in the regulation of T cell function during immunity and tolerance, PD1 inhibits T cell effector functions upon ligand binding. The protein is expressed in pro-B-cells and is thought to play a role in their differentiation as well. Studies have also suggested that this gene product may also contribute to the prevention of autoimmune diseases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

7268-CT
Species: Hu
Applications: BA
NBP1-76769
Species: Hu, Mu, Rt
Applications: Dual ISH-IHC, ELISA, Flow, ICC/IF, IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, IP, KD, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
MAB1224
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
MAB140
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
202-IL
Species: Hu
Applications: BA
DY417
Species: Mu
Applications: ELISA
MAB342
Species: Hu
Applications: AgAct, ICC, WB
169-CS
Species: Hu
Applications: BA
NB100-39002
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
DR2A00
Species: Hu
Applications: ELISA
H00003669-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
AF2365
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, KO, WB
NBP2-25208
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
6507-IL/CF
Species: Hu
Applications: BA

Publications for PD-1 Antibody (NBP2-61625) (0)

There are no publications for PD-1 Antibody (NBP2-61625).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PD-1 Antibody (NBP2-61625) (0)

There are no reviews for PD-1 Antibody (NBP2-61625). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PD-1 Antibody (NBP2-61625) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PD-1 Products

Bioinformatics Tool for PD-1 Antibody (NBP2-61625)

Discover related pathways, diseases and genes to PD-1 Antibody (NBP2-61625). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PD-1 Antibody (NBP2-61625)

Discover more about diseases related to PD-1 Antibody (NBP2-61625).
 

Pathways for PD-1 Antibody (NBP2-61625)

View related products by pathway.

PTMs for PD-1 Antibody (NBP2-61625)

Learn more about PTMs related to PD-1 Antibody (NBP2-61625).
 

Research Areas for PD-1 Antibody (NBP2-61625)

Find related products by research area.

Blogs on PD-1.

Tired T cells: Hypoxia Drives T cell Exhaustion in the Tumor Microenvironment
By Hunter MartinezThe paradigm shifting view of the immune system being leveraged to target cancer has led to numerous therapeutic breakthroughs. One major cell group responsible for this revelation is a T cell. ...  Read full blog post.

Synthetic Biotic Medicine as Immunotherapy Against Cancer: Evidence From Arginine-Producing Engineered Bacteria
By Jamshed Arslan, Pharm D, PhDWhat do nuts, dairy and red meat have in common? In addition to the fact that they are all edible, one of the answers is L-arginine. This amino acid improves T cell’s respons...  Read full blog post.

Thomson Reuters Predicts 2016 Nobel Prize Winners
Here at Bio-Techne we always look forward to the annual announcements of winners of the highly coveted Nobel Prize – the greatest award in science. How can you go about predicting which scientists might be in line for a life-changing phone-call fro...  Read full blog post.

Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PD-1 Antibody (CL3624) and receive a gift card or discount.

Bioinformatics

Gene Symbol PDCD1