Home » PD-1 » PD-1 Antibodies » PD-1 Antibody (CL3624)

PD-1 Antibody (CL3624)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: PD-1 Antibody (CL3624) [NBP2-61625] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells)
Western Blot: PD-1 Antibody (CL3624) [NBP2-61625] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry: PD-1 Antibody (CL3624) [NBP2-61625] - Staining of human liver shows absence of immunoreactivity (negative control).
Immunohistochemistry: PD-1 Antibody (CL3624) [NBP2-61625] - Staining of human tonsil shows strong immunoreactivity in a subset of lymphoid cells, mainly in the reaction centrum.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clone
CL3624
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

PD-1 Antibody (CL3624) Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: WFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAIS
Epitope
CRFRVTQLPNGRDFH
Specificity
Specificity of human PD-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
PDCD1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
IHC-Paraffin HIER pH6 retrieval is recommended.
Control
PD-1 Knockout HeLa Cell Lysate
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for PD-1 Antibody (CL3624)

  • CD279 antigen
  • CD279
  • hPD-1
  • PD1
  • PD-1
  • PD1hPD-l
  • PDCD1
  • programmed cell death 1
  • programmed cell death protein 1
  • Protein PD-1
  • SLEB2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Reviews)
(1 Publication)
Species: Hu
PD-L1 Antibody
NBP1-76769
Western Blot: PD-L1 Antibody [NBP1-76769] - Independent Antibody Validation (IAV) via Protein Expression ProfileLoading: 15 ug of lysates per lane.Antibodies: NBP1-76769 (2 ug/mL), PD-L1 (2 ug/mL), and beta-actin (1 ug/mL), 1 h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit and or anti-mouse IgG HRP conjugate at 1:10000 and 1:5000 dilution, respectively.
Immunohistochemistry-Paraffin: PD-L1 Antibody [NBP1-76769] - PD-L1/B7-H1 Antibody [NBP1-76769] - PD-L1 in rat heart tissue with at 5 ug/mL.
Flow Cytometry: PD-L1 Antibody [NBP1-76769] - B7-H1/PD-L1/CD274 Antibody [NBP1-76769] - Analysis of A-20 cells using B7-H1/PD-L1/CD274 antibody at 0.5 ug/ml. Green: Isotype control. Red : B7-H1/PD-L1/CD274 antibody.
(4 Reviews)
(12 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IHC-P, IF, KD
NOD2 Antibody (2D9)
NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: NOD2 Antibody (2D9) [NB100-524] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-NOD2 (2D9) NB100-524 at a 1:200 dilution overnight at 4C and detected with an anti-mouse DyLight 488 (Green) at a 1:500 dilution. Actin was counterstained with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(16 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
HLA DQ Antibody
(SPV-L3)
NBP2-45041
HLA DQ Antibody (SPV-L3)
Species: Hu, Po
Applications: Flow, IHC-Fr, IF

PD-L2/B7-DC/PDCD1LG2 A
NBP1-76770
Western Blot: PD-L2/B7-DC/PDCD1LG2 Antibody [NBP1-76770] - Analysis of PD-L2 in Raji cell lysate with PD-L2 antibody at 0.5 and 1 ug/mL.
Immunocytochemistry/Immunofluorescence: PD-L2/B7-DC/PDCD1LG2 Antibody [NBP1-76770] - Staining of PD-L2 in mouse brain tissue with PD-L2 antibody at 20 ug/ml.
Immunohistochemistry: PD-L2/B7-DC/PDCD1LG2 Antibody [NBP1-76770] - Staining of mouse brain tissue with antibody at 2.5 ug/ml.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
B7-1/CD80 Antibody
(62N3G8)
NBP2-25255
Western Blot: B7-1/CD80 Antibody (62N3G8) [NBP2-25255] - Analysis in human Raji lymphoma cells.
Immunohistochemistry-Paraffin: B7-1/CD80 Antibody (62N3G8) [NBP2-25255] - Human thymus stained with CD80 antibody at 5 ug/ml using peroxidase-conjugate and DAB chromogen. Note membrane and cytoplasmic staining.
Flow Cytometry: B7-1/CD80 Antibody (62N3G8) [NBP2-25255] - Raji lymphoma cells. Image from verified customer review.
(2 Reviews)
(1 Publication)
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
CD4 Antibody
NBP1-19371
Western Blot: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in the following cell lysates: 1) human spleen 2) human tonsil 3) human placenta 4) human kidney 5) human liver 6) mouse spleen 7) mouse placenta 8) rat placenta.
Immunocytochemistry/Immunofluorescence: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in Jurkat cells with DyLight 488 (green). Nuclei were counterstained with DAPI (blue).
Immunohistochemistry-Paraffin: CD4 Antibody [NBP1-19371] - Alcohol-fixed paraffin-embedded rat spleen tissue. Dilution 1:150. Image from verified customer review.
(8 Reviews)
(17 Publications)
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
CD8 Antibody
(53-6.7)
NBP1-49045
Immunocytochemistry/Immunofluorescence: CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of immersion fixed splenocytes. Primary antibody was used at a dilution of 10 ug/mL and incubated for 3 hours at room temperature.
Immunohistochemistry-Frozen: CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of CD8+ T cells in allogeneic skin grafted onto a mouse.
Flow Cytometry: CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of lymph nodes by multiple staining.
(2 Reviews)
(12 Publications)
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
IL-2 [Unconjugated]
202-IL
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
(18 Reviews)
(272 Publications)
Species: Hu
CD28 Antibody
(37407) [Unconjugated
MAB342
Human CD28 Monoclonal Antibody enhances IL-2 secretion in the Jurkat human acute T cell leukemia cell line stimulated with 10 ng/mL phorbol myristate acetate (PMA) and 0.5 μM calcium ionophore, in a dose-dependent manner, as measured using the Quantikine Human IL-2 ELISA Kit (Catalog # D2050). The ED50 for this effect is typically 0.2-0.6 μg/mL.
(26 Publications)
Species: Hu
Applications: WB, AgAct
ICOS Antibody
AF169
ICOS was detected in immersion fixed paraffin-embedded sections of human tonsil using Goat Anti-Human ICOS Antigen Affinity-purified Polyclonal Antibody (Catalog # AF169) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: WB, IHC
IFN-gamma
[Unconjugated]
285-IF
1 μg/lane of Recombinant Human IFN-gamma was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is 0.15‑0.75 ng/mL.
(13 Reviews)
(306 Publications)
Species: Hu
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(24 Reviews)
(590 Publications)
Species: Hu
FoxP3 Antibody
NB100-39002
Immunohistochemistry-Paraffin: FoxP3 Antibody [NB100-39002] - Mouse spleen stained with FoxP3 antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: FoxP3 Antibody [NB100-39002] - Tissue section of human tonsil using 1:200 dilution of rabbit anti-FoxP3 antibody. The staining was developed with HRP-labeled anti-rabbit IgG secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. This FoxP3 antibody generated an expected and a specific nuclear staining of FOXP3 in a subset of cells which are potentially the Treg cells.
Immunohistochemistry: FoxP3 Antibody [NB100-39002] - Antibody was tested in mouse spleen using DAB with hematoxylin counterstain.
(1 Review)
(13 Publications)
Species: Hu, Mu, Rt
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, IP
ISG20 Antibody
(1B2-3C9)
H00003669-M01
Western Blot: ISG20 Antibody (1B2-3C9) [H00003669-M01] - Analysis of ISG20 expression in transfected 293T cell line by ISG20 monoclonal antibody (M01), clone 1B2-3C9.Lane 1: ISG20 transfected lysate(20.4 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: ISG20 Antibody (1B2-3C9) [H00003669-M01] - Analysis of monoclonal antibody to ISG20 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: ISG20 Antibody (1B2-3C9) [H00003669-M01] - Detection limit for recombinant GST tagged ISG20 is approximately 0.1ng/ml as a capture antibody.
(2 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF
TIM-3 Antibody
[Unconjugated]
AF2365
TIM‑3 was detected in immersion fixed paraffin-embedded sections of human tonsil using Goat Anti-Human TIM‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2365) at 3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cell membranes and extracellular space. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(2 Reviews)
(15 Publications)
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
B7-2/CD86 Antibody
(BU63)
NBP2-25208
Knockout Validated: B7-2/CD86 Antibody (BU63) [NBP2-25208] - Western blot shows lysates of Ramos human Burkitt's lymphoma parental cell line and B7-2 knockout (KO) Ramos cell line. PVDF membrane was probed with 1.0 ug/mL of Mouse Anti-Human B7-2 Monoclonal Antibody (Catalog # NBP2-25208) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for B7-2 at approximately 90 kDa (as indicated) in the parental Ramos cell line, but is not detectable in the knockout Ramos cell line. This experiment was conducted under reducing conditions.
Immunohistochemistry-Paraffin: B7-2/CD86 Antibody (BU63) [NBP2-25208] - Formalin-fixed, paraffin-embedded esophagus tumor tissue stained with CD86 antibody (5 ug/ml), peroxidase-conjugate and DAB chromogen. Note strong staining of differentiated squamous cells. TMA was used for this test.
Flow Cytometry: B7-2/CD86 Antibody (BU63) [NBP2-25208] - Surface staining of CD86 on 10^6 PBMC using 0.25 ug of CD86 antibody.
(6 Publications)
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, KO
IL-4
6507-IL/CF
IL-4
(3 Publications)
Species: Hu

Publications for PD-1 Antibody (NBP2-61625) (0)

There are no publications for PD-1 Antibody (NBP2-61625).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PD-1 Antibody (NBP2-61625) (0)

There are no reviews for PD-1 Antibody (NBP2-61625). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PD-1 Antibody (NBP2-61625) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

PD-1 Knockout HeLa Cell Lysate

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional PD-1 Products

Bioinformatics Tool for PD-1 Antibody (NBP2-61625)

Discover related pathways, diseases and genes to PD-1 Antibody (NBP2-61625). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PD-1 Antibody (NBP2-61625)

Discover more about diseases related to PD-1 Antibody (NBP2-61625).
 

Pathways for PD-1 Antibody (NBP2-61625)

View related products by pathway.

PTMs for PD-1 Antibody (NBP2-61625)

Learn more about PTMs related to PD-1 Antibody (NBP2-61625).
 

Research Areas for PD-1 Antibody (NBP2-61625)

Find related products by research area.

Blogs on PD-1.

Check out the latest blog posts on PD-1.
Thomson Reuters Predicts 2016 Nobel Prize Winners
Here at Bio-Techne we always look forward to the annual announcements of winners of the highly coveted Nobel Prize – the greatest award in science. How can you go about predicting which scientists might be in line for a life-changing phone-call fro...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PD-1 Antibody (CL3624) and receive a gift card or discount.


Bioinformatics

Gene Symbol PDCD1