Home » PD-1 » PD-1 Antibodies » PD-1 Antibody (CL3624)

PD-1 Antibody (CL3624)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: PD-1 Antibody (CL3624) [NBP2-61625] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells)
Western Blot: PD-1 Antibody (CL3624) [NBP2-61625] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry: PD-1 Antibody (CL3624) [NBP2-61625] - Staining of human liver shows absence of immunoreactivity (negative control).
Immunohistochemistry: PD-1 Antibody (CL3624) [NBP2-61625] - Staining of human tonsil shows strong immunoreactivity in a subset of lymphoid cells, mainly in the reaction centrum.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clone
CL3624
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

PD-1 Antibody (CL3624) Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: WFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAIS
Epitope
CRFRVTQLPNGRDFH
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
PDCD1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 1 ug/ml
Application Notes
IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
PD-1 Recombinant Protein Antigen (NBP2-61625PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for PD-1 Antibody (CL3624)

  • CD279 antigen
  • CD279
  • hPD-1
  • PD1
  • PD-1
  • PD1hPD-l
  • PDCD1
  • programmed cell death 1
  • programmed cell death protein 1
  • Protein PD-1
  • SLEB2

Background

PD1 is an inhibitory cell membrane surface receptor from the immunoglobulin superfamily. Involved in the regulation of T cell function during immunity and tolerance, PD1 inhibits T cell effector functions upon ligand binding. The protein is expressed in pro-B-cells and is thought to play a role in their differentiation as well. Studies have also suggested that this gene product may also contribute to the prevention of autoimmune diseases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Publications)
Species: Hu
Applications: BA
PD-L1 Antibody -
BSA Free
NBP1-76769
Flow Cytometry: PD-L1 Antibody [NBP1-76769] - B7-H1/PD-L1/CD274 Antibody [NBP1-76769] - Analysis of A-20 cells using B7-H1/PD-L1/CD274 antibody at 0.5 ug/mL. Green: Isotype control. Red : B7-H1/PD-L1/CD274 antibody.
Immunohistochemistry-Paraffin: PD-L1 Antibody [NBP1-76769] - B7-H1/PD-L1/CD274 Antibody [NBP1-76769] - Human tonsil tissue with PD-L1 antibody at 5 ug/mL.
Immunofluorescence: PD-L1 Antibody [NBP1-76769] - Human Heart cells with PD-L1 antibody at 20 ug/mL.
(5 Reviews)
(33 Publications)
Species: Hu, Mu, Rt
Applications: Dual ISH-IHC, ELISA, Flow, ICC/IF, IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, IP, KD, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.Both antibodies were conjugated to phycoerythrin.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(24 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Analysis of Protein Array containing more than 19,000 full-length human proteins using HLA DQ/DR/DP Antibody (HLA-Pan/2967R). Z- and S- Score: The Z-score represents the strength of a signal that a monoclonal antibody (MAb) (in combination with a fluorescently-tagged anti-IgG secondary antibody) produces when binding to a particular protein on the HuProt(TM) array. Z-scores are described in units of standard deviations (SD's) above the mean value of all signals generated on that array. If targets on HuProt(TM) are arranged in descending order of the Z-score, the S-score is the difference (also in units of SD's) between the Z-score. S-score therefore represents the relative target specificity of a MAb to its intended target. A MAb is considered to specific to its intended target, if the MAb has an S-score of at least 2.5.
Immunocytochemistry/Immunofluorescence: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Immunofluorescence staining of Raji cells using HLA DQ/DR/DP Antibody (HLA-Pan/2967R) followed by goat anti-rabbit IgG-CF488 (Green). Nuclei stained with RedDot (Red).
Western Blot: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Western Blot Analysis of Ramos cell lysate using HLA DQ/DR/DP Antibody (HLA-Pan/2967R).
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB

PD-L2/B7-DC/PDCD1LG2 A ...
MAB1224
PD‑L2/B7‑DC was detected in immersion fixed paraffin-embedded sections of human lung cancer tissue using Mouse Anti-Human PD‑L2/B7‑DC Monoclonal Antibody (Catalog # MAB1224) at 0.5 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
HepG2 human hepatocellular carcinoma cell line was stained with Human PD‑L2 Monoclonal Antibody (Catalog # MAB1224, filled histogram) or isotype control antibody (Catalog # MAB0041, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG F(ab')2 Secondary Antibody (Catalog # F0102B).
(13 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
B7-1/CD80 Antibody
(37711) [Unconjugated ...
MAB140
Raji human Burkitt's lymphoma cell line was stained with Mouse Anti-Human B7‑1/CD80 Monoclonal Antibody (Catalog # MAB140, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Fluorescein-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0103B). View our protocol for Staining Membrane-associated Proteins.
B7‑1/CD80 was detected in immersion fixed paraffin-embedded sections of human tonsil using Mouse Anti-Human B7‑1/CD80 Monoclonal Antibody (Catalog # MAB140) at 5 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in lymphocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
B7-1/CD80 mRNA was detected in formalin-fixed paraffin-embedded tissue sections of human tonsil probed with ACD RNAScope® Probe (Catalog # 42471) and stained using ACD RNAscope® 2.5 HD Duplex Detection Reagents (red, Catalog # 322500). Adjacent tissue section was processed for immunohistochemistry using R&D Systems Mouse Anti-Human B7-1/CD80 Monoclonal Antibody (Catalog# MAB140) at 5ug/mL with overnight incubation at 4 °C followed by incubation with the Anti-Mouse IgG VisUCyte HRP Polymer Antibody (R&D Systems,  Catalog # VC001) and DAB chromogen (lower image, brown). Tissues were counterstained with hematoxylin (blue).
(14 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen: CD4 Antibody [NBP1-19371] - Staining in mouse liver tissue.
Immunohistochemistry-Paraffin: CD4 Antibody [NBP1-19371] - Alcohol-fixed paraffin-embedded rat spleen tissue. Dilution 1:150. Image from verified customer review.
Flow Cytometry: CD4 Antibody [NBP1-19371] - An intracellular stain was performed on Jurkat cells with CD4 Antibody NBP1-19371R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 550.
(9 Reviews)
(41 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
CD8 Antibody
(53-6.7) - BSA Free
NBP1-49045
Immunohistochemistry-Paraffin: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - CD8 alpha expression in mouse spleen tissue using anti-CD8 alpha antibody. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of bone marrow tissue by single and multiple staining.
Immunohistochemistry-Frozen: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of mosue spleen sections. CD8+ lymphocytes are marked by brown labeling of the cell surface.
(3 Reviews)
(20 Publications)
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
IL-2 [Unconjugated]
202-IL
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
(4 Reviews)
(349 Publications)
Species: Hu
Applications: BA
IL-10 [Biotin]
DY417
(266 Publications)
Species: Mu
Applications: ELISA
CD28 Antibody
(37407) [Unconjugated
MAB342
Human CD28 Monoclonal Antibody enhances IL-2 secretion in the Jurkat human acute T cell leukemia cell line stimulated with 10 ng/mL phorbol myristate acetate (PMA) and 0.5 μM calcium ionophore, in a dose-dependent manner, as measured using the Quantikine Human IL-2 ELISA Kit (Catalog # D2050). The ED50 for this effect is typically 0.2-0.6 μg/mL.
CD28 was detected in immersion fixed U266 human myeloma cell line (Positive) & K562 human chronic myelogenous leukemia cell line (Negative) using Mouse Anti-Human CD28 Monoclonal Antibody (Catalog # MAB342) at 8 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to Cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(1 Review)
(37 Publications)
Species: Hu
Applications: AgAct, ICC, WB
ICOS [Unconjugated]
169-CS
Recombinant Human ICOS Fc Chimera (Catalog # 169-CS) inhibits rhB7-H2/FcChimera (Catalog # 165-B7) induced human T cell proliferation in the presence of anti-CD3. The ED50 for this effect is 1‑4 µg/mL.
(3 Publications)
Species: Hu
Applications: BA
IFN-gamma
[Unconjugated]
285-IF
Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The activity is over 2-fold greater than the top competitor's IFN-gamma .
1 μg/lane of Recombinant Human IFN-gamma was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
(2 Reviews)
(415 Publications)
Species: Hu
Applications: BA
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(3 Reviews)
(740 Publications)
Species: Hu
Applications: BA
FoxP3 Antibody -
BSA Free
NB100-39002
Flow Cytometry: FoxP3 Antibody [NB100-39002] - An intracellular stain was performed on MCF7 cells with FoxP3 Antibody NB100-39002PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin.
Flow Cytometry: FoxP3 Antibody [NB100-39002] - An intracellular stain was performed on SK-MEL-28 cells with NB100-39002 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody.
Immunohistochemistry-Paraffin: FoxP3 Antibody [NB100-39002] - FFPE bovine spleen tissue. Deparaffinization and antigen retrieval was carried out with PTlink from Dako, citrate buffer pH 6. Anti-Foxp3 antibody was used at a 1:100 dilution. Secondary reagent: Envision, from Dako. Staining: DAB and hematoxylin. IHC-P image submitted by a verified customer review.
(2 Reviews)
(38 Publications)
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
CD25/IL-2R alpha
[HRP]
DR2A00
(35 Publications)
Species: Hu
Applications: ELISA
ISG20 Antibody
(1B2-3C9)
H00003669-M01
Western Blot: ISG20 Antibody (1B2-3C9) [H00003669-M01] - Analysis of ISG20 expression in transfected 293T cell line by ISG20 monoclonal antibody (M01), clone 1B2-3C9.Lane 1: ISG20 transfected lysate(20.4 KDa).Lane 2: Non-transfected lysate.
Western Blot: ISG20 Antibody (1B2-3C9) [H00003669-M01] - BT-474, HCC1954 and SUM190 whole cell lysates were loaded with 40 ug/lane. 10% SDS-PAGE. ISG20 Antibody (H00003669-M01) was used for primary antibody: 1:1000, 4C, overnight. WB image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: ISG20 Antibody (1B2-3C9) [H00003669-M01] - Analysis of monoclonal antibody to ISG20 on HeLa cell . Antibody concentration 10 ug/ml.
(1 Review)
(2 Publications)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
TIM-3 Antibody
[Unconjugated]
AF2365
TIM‑3 was detected in immersion fixed paraffin-embedded sections of human tonsil using Goat Anti-Human TIM‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2365) at 3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cell membranes and extracellular space. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
TIM-3 mRNA was detected in formalin-fixed paraffin-embedded tissue sections of human tonsil probed with ACD RNAScope® Probe (Catalog # 560681) and stained using ACD RNAscope® 2.5 HD Detection Reagents-Red (top image, Catalog # 32260). Adjacent tissue section was processed for immunohistochemistry using R&D Systems Goat Anti-Human TIM-3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2365) at 3 ug/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte HRP Polymer Antibody (R&D Systems, Catalog # VC004) and DAB chromogen (lower image, yellow-brown). Tissues were counterstained with hematoxylin (blue).
(2 Reviews)
(18 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, KO, WB
B7-2/CD86 Antibody
(BU63)
NBP2-25208
Knockout Validated: B7-2/CD86 Antibody (BU63) [NBP2-25208] - Western blot shows lysates of Ramos human Burkitt's lymphoma parental cell line and B7-2 knockout (KO) Ramos cell line. PVDF membrane was probed with 1.0 ug/mL of Mouse Anti-Human B7-2 Monoclonal Antibody (Catalog # NBP2-25208) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for B7-2 at approximately 90 kDa (as indicated) in the parental Ramos cell line, but is not detectable in the knockout Ramos cell line. This experiment was conducted under reducing conditions.
Immunocytochemistry/Immunofluorescence: B7-2/CD86 Antibody (BU63) [NBP2-25208] - Immunofluorescence staining of PFA-fixed Ramos cells using followed by goat anti-Mouse IgG conjugated to CF488 (green). Nuclei are stained with Red Dot.
Flow Cytometry: B7-2/CD86 Antibody (BU63) [NBP2-25208] - Flow Cytometric Analysis of human PBMCs using B7-2/CD86 Antibody (BU63); Goat anti-Mouse IgG-CF488 (red); Isotype Control (green).
(15 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
IL-4 [Unconjugated]
6507-IL/CF
Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is 0.05-0.2 ng/mL.
(3 Publications)
Species: Hu
Applications: BA

Publications for PD-1 Antibody (NBP2-61625) (0)

There are no publications for PD-1 Antibody (NBP2-61625).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PD-1 Antibody (NBP2-61625) (0)

There are no reviews for PD-1 Antibody (NBP2-61625). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PD-1 Antibody (NBP2-61625) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PD-1 Products

Bioinformatics Tool for PD-1 Antibody (NBP2-61625)

Discover related pathways, diseases and genes to PD-1 Antibody (NBP2-61625). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PD-1 Antibody (NBP2-61625)

Discover more about diseases related to PD-1 Antibody (NBP2-61625).
 

Pathways for PD-1 Antibody (NBP2-61625)

View related products by pathway.

PTMs for PD-1 Antibody (NBP2-61625)

Learn more about PTMs related to PD-1 Antibody (NBP2-61625).
 

Research Areas for PD-1 Antibody (NBP2-61625)

Find related products by research area.

Blogs on PD-1.

Check out the latest blog posts on PD-1.
Tired T cells: Hypoxia Drives T cell Exhaustion in the Tumor Microenvironment
By Hunter MartinezThe paradigm shifting view of the immune system being leveraged to target cancer has led to numerous therapeutic breakthroughs. One major cell group responsible for this revelation is a T cell. ...  Read full blog post.
Synthetic Biotic Medicine as Immunotherapy Against Cancer: Evidence From Arginine-Producing Engineered Bacteria
By Jamshed Arslan, Pharm D, PhDWhat do nuts, dairy and red meat have in common? In addition to the fact that they are all edible, one of the answers is L-arginine. This amino acid improves T cell’s respons...  Read full blog post.
Thomson Reuters Predicts 2016 Nobel Prize Winners
Here at Bio-Techne we always look forward to the annual announcements of winners of the highly coveted Nobel Prize – the greatest award in science. How can you go about predicting which scientists might be in line for a life-changing phone-call fro...  Read full blog post.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PD-1 Antibody (CL3624) and receive a gift card or discount.


Bioinformatics

Gene Symbol PDCD1