PCYOX1 Antibody

Images

 
Immunohistochemistry-Paraffin: PCYOX1 Antibody [NBP1-81462] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PCYOX1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HDYAFSSVEKLLHALGGDDFLGMLNRTLLETLQKAGFSEKFLNEMIAPVMRVNYGQSTDINAFVGAVSLSCSDS
Specificity
Specificity of human PCYOX1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCYOX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PCYOX1 Protein (NBP1-81462PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PCYOX1 Antibody

  • EC 1.8.3.5
  • KIAA0908PCL1Prenylcysteine lyase
  • prenylcysteine oxidase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6846
Species: Hu
Applications: IHC
NBP2-45388
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31758
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00007702-M01
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF, IHC-P
44260002
Species: Hu
Applications: WB, ELISA
AF743
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP2-67591
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-43782
Species: Hu
Applications: WB
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi, ICC
NBP1-86614
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP2-29915
Species: Hu
Applications: WB, ICC/IF, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00008706-P01
Species: Hu
NBP2-16558
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
NBP1-81462
Species: Hu
Applications: IHC, IHC-P

Publications for PCYOX1 Antibody (NBP1-81462) (0)

There are no publications for PCYOX1 Antibody (NBP1-81462).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCYOX1 Antibody (NBP1-81462) (0)

There are no reviews for PCYOX1 Antibody (NBP1-81462). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PCYOX1 Antibody (NBP1-81462) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PCYOX1 Antibody (NBP1-81462)

Discover related pathways, diseases and genes to PCYOX1 Antibody (NBP1-81462). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCYOX1 Antibody (NBP1-81462)

Discover more about diseases related to PCYOX1 Antibody (NBP1-81462).
 

Pathways for PCYOX1 Antibody (NBP1-81462)

View related products by pathway.

PTMs for PCYOX1 Antibody (NBP1-81462)

Learn more about PTMs related to PCYOX1 Antibody (NBP1-81462).

Blogs on PCYOX1

There are no specific blogs for PCYOX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCYOX1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCYOX1