PCPTP1 Antibody

Images

 
Immunohistochemistry-Paraffin: PCPTP1 Antibody [NBP1-84912] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PCPTP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YDPSLNLLAMDGQDLEVENLPIPAANVIVVTLQMDVNKLNITLLRIFRQGVAAALGLLPQQVHINRLIGKKNSIELFVSPINRKTGISDALPSEEVLRSLNINVLHQSLSQFGITEVSPEKNVLQGQHE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTPRR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
PCPTP1 Protein (NBP1-84912PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PCPTP1 Antibody

  • Ch-1 PTPase
  • ch-1PTPase
  • DKFZp781C1038
  • EC 3.1.3.48
  • ECPTP
  • EC-PTP
  • FLJ34328
  • MGC131968
  • MGC148170
  • NC-PTPCOM1
  • PCPTP1
  • protein tyrosine phosphatase Cr1PTPase
  • protein tyrosine phosphatase, receptor type, R
  • protein-tyrosine phosphatase NC-PTPCOM1
  • Protein-tyrosine phosphatase PCPTP1
  • PTPBR7
  • PTPRQ
  • PTP-SL
  • receptor-type tyrosine-protein phosphatase R
  • R-PTP-R

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB7475
Species: Hu, Rt
Applications: WB
AF4937
Species: Hu
Applications: WB, IHC
H00005250-B02P
Species: Hu
Applications: WB, ICC/IF
NBP2-01340
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NLS6792
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NB300-202
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF932
Species: Hu
Applications: WB, Simple Western, IHC, ICC

Publications for PCPTP1 Antibody (NBP1-84912) (0)

There are no publications for PCPTP1 Antibody (NBP1-84912).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCPTP1 Antibody (NBP1-84912) (0)

There are no reviews for PCPTP1 Antibody (NBP1-84912). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PCPTP1 Antibody (NBP1-84912) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PCPTP1 Products

Bioinformatics Tool for PCPTP1 Antibody (NBP1-84912)

Discover related pathways, diseases and genes to PCPTP1 Antibody (NBP1-84912). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCPTP1 Antibody (NBP1-84912)

Discover more about diseases related to PCPTP1 Antibody (NBP1-84912).
 

Pathways for PCPTP1 Antibody (NBP1-84912)

View related products by pathway.

PTMs for PCPTP1 Antibody (NBP1-84912)

Learn more about PTMs related to PCPTP1 Antibody (NBP1-84912).
 

Research Areas for PCPTP1 Antibody (NBP1-84912)

Find related products by research area.

Blogs on PCPTP1

There are no specific blogs for PCPTP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCPTP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTPRR