PCPTP1 Antibody - BSA Free

Images

 
Immunohistochemistry-Paraffin: PCPTP1 Antibody [NBP1-84912] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: PCPTP1 Antibody [NBP1-84912] - Staining of human cerebral cortex shows moderate positivity in neuropil.
Immunohistochemistry-Paraffin: PCPTP1 Antibody [NBP1-84912] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: PCPTP1 Antibody [NBP1-84912] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

PCPTP1 Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit PCPTP1 Antibody - BSA Free (NBP1-84912) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YDPSLNLLAMDGQDLEVENLPIPAANVIVVTLQMDVNKLNITLLRIFRQGVAAALGLLPQQVHINRLIGKKNSIELFVSPINRKTGISDALPSEEVLRSLNINVLHQSLSQFGITEVSPEKNVLQGQHE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTPRR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PCPTP1 Protein (NBP1-84912PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PCPTP1 Antibody - BSA Free

  • Ch-1 PTPase
  • ch-1PTPase
  • DKFZp781C1038
  • EC 3.1.3.48
  • ECPTP
  • EC-PTP
  • FLJ34328
  • MGC131968
  • MGC148170
  • NC-PTPCOM1
  • PCPTP1
  • protein tyrosine phosphatase Cr1PTPase
  • protein tyrosine phosphatase, receptor type, R
  • protein-tyrosine phosphatase NC-PTPCOM1
  • Protein-tyrosine phosphatase PCPTP1
  • PTPBR7
  • PTPRQ
  • PTP-SL
  • receptor-type tyrosine-protein phosphatase R
  • R-PTP-R

Background

PCPTP1, also known as Receptor-type tyrosine-protein phosphatase R, has 4 isoforms, a 657 amino acid isoform that is 74 kDa, a 412 amino acid isoform t5hat is 47 k Da, a 451 amino acid isoform that is 51 kDa, and a 545 amino acid isoform that is 61 kDa, expressed in brain, placenta, small intestine, stomach, uterus and weakly in the prostate, sequesters mitogen-activated protein kinases (MAPKs) such as MAPK1, MAPK3 and MAPK14 in the cytoplasm in an inactive form. The MAPKs bind to a dephosphorylated kinase interacting motif, phosphorylation of which by the protein kinase A complex releases the MAPKs for activation and translocation into the nucleus. The protein is being studied for its involvement in colorectal cancer, episodic ataxia, ataxia, leukemia, prostatitis, and neuronitis. This protein has also been shown to involve MAPK1, MAPK14, MAPK3, MAPK7, and CDH2 in MAPK signaling pathway, EGFR1 Signaling Pathway, Signal transduction Erk Interactions- Inhibition of Erky, and Epithelial Adherens Junctions pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
MAB7475
Species: Hu, Rt
Applications: WB
NBP2-13215
Species: Hu
Applications: IHC,  IHC-P, WB
H00005250-B02P
Species: Hu
Applications: ICC/IF, WB
NBP2-01340
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-47833
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-34952
Species: Hu
Applications: BA, PAGE
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP3-14454
Species: Hu
Applications: IHC,  IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NB300-202
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-71770
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr,  IHC-P, WB
AF932
Species: Hu
Applications: ICC, IHC, Simple Western, WB
256-GF
Species: Hu
Applications: BA
NBP1-84912
Species: Hu
Applications: IHC

Publications for PCPTP1 Antibody (NBP1-84912) (0)

There are no publications for PCPTP1 Antibody (NBP1-84912).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCPTP1 Antibody (NBP1-84912) (0)

There are no reviews for PCPTP1 Antibody (NBP1-84912). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PCPTP1 Antibody (NBP1-84912) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PCPTP1 Products

Research Areas for PCPTP1 Antibody (NBP1-84912)

Find related products by research area.

Blogs on PCPTP1

There are no specific blogs for PCPTP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCPTP1 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol PTPRR