PCPTP1 Antibody


Western Blot: PCPTP1 Antibody [NBP1-69297] - This Anti-PTPRR antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 0.25ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

PCPTP1 Antibody Summary

Synthetic peptides corresponding to PTPRR(protein tyrosine phosphatase, receptor type, R) The peptide sequence was selected from the C terminal of PTPRR. Peptide sequence NYTIRNLVLKQGSHTQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PTPRR and was validated on Western blot.
Theoretical MW
46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PCPTP1 Antibody

  • Ch-1 PTPase
  • ch-1PTPase
  • DKFZp781C1038
  • EC
  • EC-PTP
  • FLJ34328
  • MGC131968
  • MGC148170
  • PCPTP1
  • protein tyrosine phosphatase Cr1PTPase
  • protein tyrosine phosphatase, receptor type, R
  • protein-tyrosine phosphatase NC-PTPCOM1
  • Protein-tyrosine phosphatase PCPTP1
  • PTPBR7
  • PTP-SL
  • receptor-type tyrosine-protein phosphatase R
  • R-PTP-R


PTPRR is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single intracellular catalytic domains, and thus represents a receptor-type PTP.The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single intracellular catalytic domains, and thus represents a receptor-type PTP. The similar gene predominately expressed in mouse brain was found to associate with, and thus regulate the activity and cellular localization of MAP kinases. The rat counterpart of this gene was reported to be regulated by the nerve growth factor, which suggested the function of this gene in neuronal growth and differentiation. Telomerase is a ribonucleoprotein polymerase that maintains telomere ends by addition of the telomere repeat TTAGGG. The enzyme consists of a protein component with reverse transcriptase activity, and an RNA component, encoded by this gene, that serves as a template for the telomere repeat. Telomerase expression plays a role in cellular senescence, as it is normally repressed in postnatal somatic cells resulting in progressive shortening of telomeres. Deregulation of telomerase expression in somatic cells may be involved in oncogenesis. Studies in mouse suggest that telomerase also participates in chromosomal repair, since de novo synthesis of telomere repeats may occur at double-stranded breaks. Mutations in this gene cause autosomal dominant dyskeratosis congenita, and may also be associated with some cases of aplastic anemia.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, ICC
Species: Hu
Applications: WB

Publications for PCPTP1 Antibody (NBP1-69297) (0)

There are no publications for PCPTP1 Antibody (NBP1-69297).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCPTP1 Antibody (NBP1-69297) (0)

There are no reviews for PCPTP1 Antibody (NBP1-69297). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PCPTP1 Antibody (NBP1-69297) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PCPTP1 Products

Bioinformatics Tool for PCPTP1 Antibody (NBP1-69297)

Discover related pathways, diseases and genes to PCPTP1 Antibody (NBP1-69297). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCPTP1 Antibody (NBP1-69297)

Discover more about diseases related to PCPTP1 Antibody (NBP1-69297).

Pathways for PCPTP1 Antibody (NBP1-69297)

View related products by pathway.

PTMs for PCPTP1 Antibody (NBP1-69297)

Learn more about PTMs related to PCPTP1 Antibody (NBP1-69297).

Research Areas for PCPTP1 Antibody (NBP1-69297)

Find related products by research area.

Blogs on PCPTP1

There are no specific blogs for PCPTP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PCPTP1 Antibody and receive a gift card or discount.


Gene Symbol PTPRR