PCPTP1 Antibody - BSA Free

Western Blot: PCPTP1 Antibody [NBP1-59712] - Titration: 0.2-1 ug/ml, Positive Control: COLO205 cell lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PCPTP1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the N terminal of human PTPRR (NP_570897). Peptide sequence NIEPFVSIPTPREKVAMEYLQSASRILTRSQLRDVVASSHLLQSEFMEIP. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PTPRR
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 46 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PCPTP1 Antibody - BSA Free

• Ch-1 PTPase
• ch-1PTPase
• DKFZp781C1038
• EC 3.1.3.48
• ECPTP
• EC-PTP
• FLJ34328
• MGC131968
• MGC148170
• NC-PTPCOM1
• PCPTP1
• protein tyrosine phosphatase Cr1PTPase
• protein tyrosine phosphatase, receptor type, R
• protein-tyrosine phosphatase NC-PTPCOM1
• Protein-tyrosine phosphatase PCPTP1
• PTPBR7
• PTPRQ
• PTP-SL
• receptor-type tyrosine-protein phosphatase R
• R-PTP-R

Background

PTPRR is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single intracellular catalytic domains, and thus represents a receptor-type PTP.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PTPRR
• Entrez:
  • 5801(Human)
• Uniprot:
  • Q2TAJ3(Human)