PCPTP1 Antibody (5R6L5)

Western Blot: PCPTP1 Antibody (5R6L5) [NBP3-33262] - Western blot analysis of various lysates using PCPTP1 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

• Reactivity: Mu, Rt
• Applications: WB, ELISA
• Clone: 5R6L5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

PCPTP1 Antibody (5R6L5) Summary

• Description: Novus Biologicals Rabbit PCPTP1 Antibody (5R6L5) (NBP3-33262) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PCPTP1 (Q15256).
  
  Sequence:
  MRRAVCFPALCLLLNLHAAGCFSGNNDHFLAINQKKSGKPVFIYKHSQDIEKSLDIAPQKIYRHSYHSSSEAQVSKRHQIVNSAFPRPAYDPSLNLLAMD
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: PTPRR
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 74 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PCPTP1 Antibody (5R6L5)

• Ch-1 PTPase
• ch-1PTPase
• DKFZp781C1038
• EC 3.1.3.48
• ECPTP
• EC-PTP
• FLJ34328
• MGC131968
• MGC148170
• NC-PTPCOM1
• PCPTP1
• protein tyrosine phosphatase Cr1PTPase
• protein tyrosine phosphatase, receptor type, R
• protein-tyrosine phosphatase NC-PTPCOM1
• Protein-tyrosine phosphatase PCPTP1
• PTPBR7
• PTPRQ
• PTP-SL
• receptor-type tyrosine-protein phosphatase R
• R-PTP-R

Background

PCPTP1, also known as Receptor-type tyrosine-protein phosphatase R, has 4 isoforms, a 657 amino acid isoform that is 74 kDa, a 412 amino acid isoform t5hat is 47 k Da, a 451 amino acid isoform that is 51 kDa, and a 545 amino acid isoform that is 61 kDa, expressed in brain, placenta, small intestine, stomach, uterus and weakly in the prostate, sequesters mitogen-activated protein kinases (MAPKs) such as MAPK1, MAPK3 and MAPK14 in the cytoplasm in an inactive form. The MAPKs bind to a dephosphorylated kinase interacting motif, phosphorylation of which by the protein kinase A complex releases the MAPKs for activation and translocation into the nucleus. The protein is being studied for its involvement in colorectal cancer, episodic ataxia, ataxia, leukemia, prostatitis, and neuronitis. This protein has also been shown to involve MAPK1, MAPK14, MAPK3, MAPK7, and CDH2 in MAPK signaling pathway, EGFR1 Signaling Pathway, Signal transduction Erk Interactions- Inhibition of Erky, and Epithelial Adherens Junctions pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PTPRR