Immunocytochemistry/ Immunofluorescence: PCBP2 Antibody [NBP1-83241] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Staining of human testis shows strong cytoplasmic and nulcear positivity in cells in seminiferous ducts.
Novus Biologicals Rabbit PCBP2 Antibody - BSA Free (NBP1-83241) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-PCBP2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEG
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCBP2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Human reactivity reported in scientific literature (PMID: 25411354).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for PCBP2 Antibody - BSA Free
alpha-CP2
Heterogeneous nuclear ribonucleoprotein E2
heterogenous nuclear ribonucleoprotein E2
hnRNP E2
hnRNP-E2
HNRPE2
MGC110998
poly(rC) binding protein 2
poly(rC)-binding protein 2
Background
PCBP2 is encoded by this gene appears to be multifunctional. Along with PCBP-1 and hnRNPK, it is one of the major cellular poly(rC)-binding proteins. The encoded protein contains three K-homologous (KH) domains which may be involved in RNA binding. Together with PCBP-1, this protein also functions as a translational coactivator of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES, promoting poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This multiexon structural mRNA is thought to be retrotransposed to generate PCBP-1, an intronless gene with functions similar to that of PCBP2. This gene and PCBP-1 have paralogous genes (PCBP3 and PCBP4) which are thought to have arisen as a result of duplication events of entire genes. Thsi gene also has two processed pseudogenes (PCBP2P1 and PCBP2P2). Multiple transcript variants encoding several different isoforms have been found for this gene, but the full-length nature of only three have been characterized to date.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our PCBP2 Antibody - BSA Free and receive a gift card or discount.