PCBP2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PCBP2 Antibody [NBP1-83241] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: PCBP2 Antibody [NBP1-83241] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P, ICC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PCBP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCBP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Immunocytochemistry
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PCBP2 Protein (NBP1-83241PEP)
Publications
Read Publication using NBP1-83241.

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25411354).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PCBP2 Antibody

  • alpha-CP2
  • Heterogeneous nuclear ribonucleoprotein E2
  • heterogenous nuclear ribonucleoprotein E2
  • hnRNP E2
  • hnRNP-E2
  • HNRPE2
  • MGC110998
  • poly(rC) binding protein 2
  • poly(rC)-binding protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46336
Species: Hu
Applications: WB, IHC, IHC-P
AF5414
Species: Hu
Applications: WB, Simple Western
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-30975
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA
NBP2-49154
Species: Hu
Applications: IHC
NB110-40424
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NB600-1438
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IP
H00005725-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-19997
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-22380
Species: Hu
Applications: WB, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
AF4538
Species: Hu, Mu, Rt
Applications: WB
NB100-672
Species: Hu, Mu, Bv, Ca
Applications: WB, ELISA, ICC/IF, IP, MiAr
H00006428-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-83241
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, ICC

Publications for PCBP2 Antibody (NBP1-83241)(1)

We have publications tested in 1 confirmed species: Human.


Filter By Application
All Applications
Filter By Species
Human
(1)
All Species

Reviews for PCBP2 Antibody (NBP1-83241) (0)

There are no reviews for PCBP2 Antibody (NBP1-83241). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PCBP2 Antibody (NBP1-83241) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PCBP2 Products

Bioinformatics Tool for PCBP2 Antibody (NBP1-83241)

Discover related pathways, diseases and genes to PCBP2 Antibody (NBP1-83241). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCBP2 Antibody (NBP1-83241)

Discover more about diseases related to PCBP2 Antibody (NBP1-83241).
 

Pathways for PCBP2 Antibody (NBP1-83241)

View related products by pathway.

PTMs for PCBP2 Antibody (NBP1-83241)

Learn more about PTMs related to PCBP2 Antibody (NBP1-83241).

Blogs on PCBP2

There are no specific blogs for PCBP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCBP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCBP2