PCBP2 Antibody - BSA Free

Images

 
Western Blot: PCBP2 Antibody [NBP1-57323] - Sample Tissue: Human Jurkat Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: PCBP2 Antibody [NBP1-57323] - Paraffin Embedded Tissue: Human Lung Cellular Data: Alveolar cells Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X
Western Blot: PCBP2 Antibody [NBP1-57323] - Reccomended Titration: 1.25 ug/ml Positive Control: Jurkat cell lysate There is BioGPS gene expression data showing that PCBP2 is expressed in Jurkat

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Concentration
1 mg/ml

Order Details

PCBP2 Antibody - BSA Free Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to PCBP2 (poly(rC) binding protein 2) The peptide sequence was selected from the middle region of PCBP2 (NP_005007). Peptide sequence VIFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEGPPLEAYTIQGQYAIPQ. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCBP2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 4-8 ug/ml
  • Immunohistochemistry-Paraffin 4-8 ug/ml
  • Western Blot 1.0 ug/ml
Theoretical MW
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using
NBP1-57323 in the following applications:

  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
1 mg/ml
Purity
Protein A purified

Alternate Names for PCBP2 Antibody - BSA Free

  • alpha-CP2
  • Heterogeneous nuclear ribonucleoprotein E2
  • heterogenous nuclear ribonucleoprotein E2
  • hnRNP E2
  • hnRNP-E2
  • HNRPE2
  • MGC110998
  • poly(rC) binding protein 2
  • poly(rC)-binding protein 2

Background

PCBP2 appears to be multifunctional. It along with PCBP-1 and hnRNPK corresponds to the major cellular poly(rC)-binding proteins. This protein together with PCBP-1 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This gene and PCBP-1 has paralogues PCBP3 and PCBP4 which is thought to arose as a result of duplication events of entire genes.The protein encoded by this gene appears to be multifunctional. It along with PCBP-1 and hnRNPK corresponds to the major cellular poly(rC)-binding proteins. It contains three K-homologous (KH) domains which may be involved in RNA binding. This encoded protein together with PCBP-1 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This multiexon structural mRNA is thought to be retrotransposed to generate PCBP-1 intronless gene which has similar functions. This gene and PCBP-1 has paralogues PCBP3 and PCBP4 which is thought to arose as a result of duplication events of entire genes. It also has two processed pseudogenes PCBP2P1 and PCBP2P2. There are presently two alternatively spliced transcript variants described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005093-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
AF5414
Species: Hu
Applications: Simple Western, WB
NBP1-48002
Species: Ca, Hu, Pm, Pm
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-24531
Species: Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC,  IHC-P, WB
AF5129
Species: Hu
Applications: WB
NBP3-05569
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB110-41083
Species: Hu
Applications: ChIP, ELISA, ICC/IF, WB
NBP1-62489
Species: Dr, Hu, Mu
Applications: WB
NB110-40424
Species: Hu
Applications: IHC,  IHC-P, IP, WB
AF7094
Species: Hu
Applications: IHC
H00005725-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, Single-Cell Western, WB
NBP3-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-80859
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NB100-1020
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NB100-672
Species: Bv, Ca, Hu, Mu
Applications: ELISA, ICC/IF, IHC, IP, KD, MiAr, WB
H00006428-M08
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB
NBP1-57323
Species: Hu, Mu
Applications: WB, IHC

Publications for PCBP2 Antibody (NBP1-57323)(2)

Reviews for PCBP2 Antibody (NBP1-57323) (0)

There are no reviews for PCBP2 Antibody (NBP1-57323). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PCBP2 Antibody (NBP1-57323). (Showing 1 - 1 of 1 FAQs).

  1. I wanted to confirm if Cat. no. NBP1-57323 is available in liquid form & not Lyophilized form, since my one of customers is specifically interested in liquid form. Please confirm.
    • Our PCBP2 antibody with catalogue number NBP1-57323 is only available as a lyophilised product. It is supplied as 0.1mg lyophilised from PBS, and reconstitution simply involves quick centrifugation of the vial followed by the addition of 100ul distilled water. Reconstituted antibody will have a final concentration of 1 mg/ml. After reconstitution the antibody may be aliquoted (to avoid freeze-thaw cycles) and stored at -20C.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCBP2 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol PCBP2
Entrez
Uniprot