PCBD1 Antibody - BSA Free

Western Blot: PCBD1 Antibody [NBP2-57448] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.

Immunocytochemistry/Immunofluorescence: PCBD1 Antibody [NBP2-57448] - Staining of human cell line Hep G2 shows localization to nucleoplasm.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PCBD1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PCBD1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PCBD1 Recombinant Protein Antigen (NBP2-57448PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PCBD1 Antibody - BSA Free

• 4-alpha-hydroxy-tetrahydropterin dehydratase
• DCoH
• DCOHpterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocytenuclear factor 1 alpha (TCF1)
• Dimerization cofactor of hepatocyte nuclear factor 1-alpha
• Dimerization cofactor of HNF1
• PCBDdimerizing cofactor for HNF1,6-pyruvoyl-tetrahydropterin synthase/dimerization cofactor of hepatocytenuclear factor 1 alpha (TCF1)
• PCDEC 4.2.1.96
• Phenylalanine hydroxylase-stimulating protein
• PHS
• Pterin carbinolamine dehydratase
• pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocytenuclear factor 1 alpha
• pterin-4-alpha-carbinolamine dehydratase

Background

The PCBD1 gene encodes pterin-4 alpha-carbinolamine dehydratase, an enzyme involved in phenylalanine hydroxylation. Adeficiency of this enzyme leads to hyperphenylalaninemia. The enzyme regulates the homodimerization of thetranscription factor hepatocyte nucle

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PCBD1