PBR Antibody

Images

 
Western Blot: PBR Antibody [H00000706-B01P] - Analysis of TSPO expression in transfected 293T cell line by TSPO polyclonal antibody. Lane 1: BZRP transfected lysate(18.59 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: PBR Antibody [H00000706-B01P] - Immunofluorescence of purified MaxPab antibody to BZRP on HeLa cell. [antibody concentration 10 ug/ml]

Product Details

Summary
Product Discontinued
View other related PBR Primary Antibodies

Order Details


    • Catalog Number
      H00000706-B01P
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PBR Antibody Summary

Immunogen
TSPO (AAH01110.1, 1 a.a. - 169 a.a.) full-length human protein. MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFATTLNYCVWRDNHGWHGGRRLPE
Specificity
TSPO - translocator protein (18kDa),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
TSPO
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been used for IF.
Control
PBR Knockout HeLa Cell Lysate

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PBR Antibody

  • benzodiazepine peripheral binding site
  • BZRPDBI
  • IBP
  • MBRPBS
  • mDRC
  • Mitochondrial benzodiazepine receptor
  • PBR
  • PBRBPBS
  • PBRS
  • peripheral benzodiazepine receptor
  • Peripheral-type benzodiazepine receptor
  • pk18
  • PKBSbenzodiazapine receptor (peripheral)
  • PTBR
  • translocator protein (18kDa)
  • translocator protein
  • TSPO

Background

Present mainly in the mitochondrial compartment of peripheral tissues, the protein encoded by this gene interacts with some benzodiazepines and has different affinities than its endogenous counterpart. The protein is a key factor in the flow of cholesterol into mitochondria to permit the initiation of steroid hormone synthesis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90824
Species: Hu
Applications: WB, ICC/IF
H00051776-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, PA, B/N, KD
NBP1-33485
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-922
Species: Ch, V-Vi
Applications: WB, ELISA, IHC, IHC-P, IP
NB100-124
Species: Hu, Mu, Rt, Bv, Ma, Pm, Sh
Applications: WB, ChIP, GS, IB, ICC/IF, IHC, IHC-P, IP, CHIP-SEQ
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-128
Species: Hu, Mu, Rt
Applications: GS, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA

Publications for PBR Antibody (H00000706-B01P) (0)

There are no publications for PBR Antibody (H00000706-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PBR Antibody (H00000706-B01P) (0)

There are no reviews for PBR Antibody (H00000706-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PBR Antibody (H00000706-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PBR Products

Array H00000706-B01P

Bioinformatics Tool for PBR Antibody (H00000706-B01P)

Discover related pathways, diseases and genes to PBR Antibody (H00000706-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PBR Antibody (H00000706-B01P)

Discover more about diseases related to PBR Antibody (H00000706-B01P).
 

Pathways for PBR Antibody (H00000706-B01P)

View related products by pathway.

PTMs for PBR Antibody (H00000706-B01P)

Learn more about PTMs related to PBR Antibody (H00000706-B01P).
 

Research Areas for PBR Antibody (H00000706-B01P)

Find related products by research area.

Blogs on PBR

There are no specific blogs for PBR, but you can read our latest blog posts.
Coronavirus Brochure

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PBR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TSPO
Entrez
Uniprot