PBLD Antibody

Images

 
Western Blot: PBLD Antibody [NBP1-83682] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: PBLD Antibody [NBP1-83682] - Staining of human liver shows strong cytoplasmic, membranous and nuclear positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PBLD Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LSGELRARRAEDGIVLDLPLYPAHPQDFHEVEDLIKTAIGNTLVQDICYSPDTQKLLVRLSDVYNRSFLENLKVNTE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PBLD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PBLD Protein (NBP1-83682PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PBLD Antibody

  • EC 5.1
  • FLJ14767
  • FLJ35507
  • MAWBPMAWDBPMAWD binding protein
  • MAWD-binding protein
  • phenazine biosynthesis-like domain-containing protein
  • phenazine biosynthesis-like protein domain containing
  • Unknown protein 32 from 2D-page of liver tissue

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-24740
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, IHC-P
NBL1-10680
Species: Hu
NB300-538
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80849
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87695
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83910
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83682
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PBLD Antibody (NBP1-83682) (0)

There are no publications for PBLD Antibody (NBP1-83682).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PBLD Antibody (NBP1-83682) (0)

There are no reviews for PBLD Antibody (NBP1-83682). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PBLD Antibody (NBP1-83682) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PBLD Products

Bioinformatics Tool for PBLD Antibody (NBP1-83682)

Discover related pathways, diseases and genes to PBLD Antibody (NBP1-83682). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PBLD Antibody (NBP1-83682)

Discover more about diseases related to PBLD Antibody (NBP1-83682).

PTMs for PBLD Antibody (NBP1-83682)

Learn more about PTMs related to PBLD Antibody (NBP1-83682).

Blogs on PBLD

There are no specific blogs for PBLD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PBLD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PBLD