PBLD Antibody - BSA Free

Immunohistochemistry-Paraffin: PBLD Antibody [NBP1-83682] - Staining in human kidney and tonsil tissues using anti-PBLD antibody. Corresponding PBLD RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: PBLD Antibody [NBP1-83682] - Staining of human liver.

Immunohistochemistry-Paraffin: PBLD Antibody [NBP1-83682] - Staining of human kidney shows high expression.

Immunohistochemistry-Paraffin: PBLD Antibody [NBP1-83682] - Staining of human tonsil shows low expression as expected.

Immunohistochemistry-Paraffin: PBLD Antibody [NBP1-83682] - Staining of human colon, duodenum, kidney and liver using Anti-PBLD antibody NBP1-83682 (A) shows similar protein distribution across tissues to independent antibody NBP1-83683 (B).

Immunohistochemistry-Paraffin: PBLD Antibody [NBP1-83682] - Staining of human colon.

Immunohistochemistry-Paraffin: PBLD Antibody [NBP1-83682] - Staining of human duodenum.

Immunohistochemistry-Paraffin: PBLD Antibody [NBP1-83682] - Staining of human kidney using Anti-PBLD antibody NBP1-83682.

Analysis using Anti-PBLD antibody NBP1-83682 (A) shows similar pattern to independent antibody NBP1-83683 (B).

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PBLD Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LSGELRARRAEDGIVLDLPLYPAHPQDFHEVEDLIKTAIGNTLVQDICYSPDTQKLLVRLSDVYNRSFLENLKVNTE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PBLD
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PBLD Protein (NBP1-83682PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PBLD Antibody - BSA Free

• EC 5.1
• FLJ14767
• FLJ35507
• MAWBPMAWDBPMAWD binding protein
• MAWD-binding protein
• phenazine biosynthesis-like domain-containing protein
• phenazine biosynthesis-like protein domain containing
• Unknown protein 32 from 2D-page of liver tissue

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PBLD