PBEF/Visfatin/NAMPT Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: QETAGIGASAHLVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGED |
Predicted Species |
Mouse (99%), Rat (99%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
NAMPT |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for PBEF/Visfatin/NAMPT Antibody
Background
NAMPT encodes a protein that catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, one step in the biosynthesis of nicotinamide adenine dinucleotide. The protein is an adipokine that is localized to the bloodstream and has various functions, including the promotion of vascular smooth muscle cell maturation and inhibition of neutrophil apoptosis. It also activates insulin receptor and has insulin-mimetic effects, lowering blood glucose and improving insulin sensitivity. The protein is highly expressed in visceral fat and serum levels of the protein correlate with obesity. This gene has a pseudogene on chromosome 10.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Po, Sh
Applications: ELISA, IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Publications for PBEF/Visfatin/NAMPT Antibody (NBP2-46755) (0)
There are no publications for PBEF/Visfatin/NAMPT Antibody (NBP2-46755).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PBEF/Visfatin/NAMPT Antibody (NBP2-46755) (0)
There are no reviews for PBEF/Visfatin/NAMPT Antibody (NBP2-46755).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PBEF/Visfatin/NAMPT Antibody (NBP2-46755) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PBEF/Visfatin/NAMPT Products
Bioinformatics Tool for PBEF/Visfatin/NAMPT Antibody (NBP2-46755)
Discover related pathways, diseases and genes to PBEF/Visfatin/NAMPT Antibody (NBP2-46755). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for PBEF/Visfatin/NAMPT Antibody (NBP2-46755)
Discover more about diseases related to PBEF/Visfatin/NAMPT Antibody (NBP2-46755).
| | Pathways for PBEF/Visfatin/NAMPT Antibody (NBP2-46755)
View related products by pathway.
|
PTMs for PBEF/Visfatin/NAMPT Antibody (NBP2-46755)
Learn more about PTMs related to PBEF/Visfatin/NAMPT Antibody (NBP2-46755).
| | Research Areas for PBEF/Visfatin/NAMPT Antibody (NBP2-46755)
Find related products by research area.
|
Blogs on PBEF/Visfatin/NAMPT