PBEF/Visfatin/NAMPT Antibody

Images

 
Western Blot: PBEF/Visfatin/NAMPT Antibody [NBP2-46755] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251 MG. Lane 4: Human plasma Lane 5: ...read more
Immunohistochemistry: PBEF/Visfatin/NAMPT Antibody [NBP2-46755] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PBEF/Visfatin/NAMPT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QETAGIGASAHLVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGED
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NAMPT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PBEF/Visfatin/NAMPT Recombinant Protein Antigen (NBP2-46755PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PBEF/Visfatin/NAMPT Antibody

  • EC 2.4.2.12
  • MGC117256
  • NAmPRTase
  • NAMPT
  • nicotinamide phosphoribosyltransferase
  • NMPRTase
  • PBEF
  • PBEF1
  • PBEF1110035O14Rik
  • PBEF1DKFZp666B131
  • Pre-B cell-enhancing factor
  • pre-B-cell colony enhancing factor 1
  • Pre-B-cell colony-enhancing factor 1
  • VF
  • Visfatin

Background

NAMPT encodes a protein that catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, one step in the biosynthesis of nicotinamide adenine dinucleotide. The protein is an adipokine that is localized to the bloodstream and has various functions, including the promotion of vascular smooth muscle cell maturation and inhibition of neutrophil apoptosis. It also activates insulin receptor and has insulin-mimetic effects, lowering blood glucose and improving insulin sensitivity. The protein is highly expressed in visceral fat and serum levels of the protein correlate with obesity. This gene has a pseudogene on chromosome 10.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
DRP300
Species: Hu
Applications: ELISA
D6050
Species: Hu
Applications: ELISA
DLP00
Species: Hu
Applications: ELISA
DRSN00
Species: Hu
Applications: ELISA
210-TA
Species: Hu
Applications: BA
NBP1-51641
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, WB
DCRP00
Species: Hu
Applications: ELISA
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-12793
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP2-31176
Species: Hu, Mu, Po, Sh
Applications: ELISA, IHC, IHC-P
DY4410
Species: Hu
Applications: ELISA
NBP1-47842
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
DRB400
Species: Hu
Applications: ELISA
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
MAB208
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
DCP00
Species: Hu
Applications: ELISA
AF5739
Species: Hu, Mu, Rt
Applications: WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-46755
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for PBEF/Visfatin/NAMPT Antibody (NBP2-46755) (0)

There are no publications for PBEF/Visfatin/NAMPT Antibody (NBP2-46755).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PBEF/Visfatin/NAMPT Antibody (NBP2-46755) (0)

There are no reviews for PBEF/Visfatin/NAMPT Antibody (NBP2-46755). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PBEF/Visfatin/NAMPT Antibody (NBP2-46755) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PBEF/Visfatin/NAMPT Products

Bioinformatics Tool for PBEF/Visfatin/NAMPT Antibody (NBP2-46755)

Discover related pathways, diseases and genes to PBEF/Visfatin/NAMPT Antibody (NBP2-46755). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PBEF/Visfatin/NAMPT Antibody (NBP2-46755)

Discover more about diseases related to PBEF/Visfatin/NAMPT Antibody (NBP2-46755).
 

Pathways for PBEF/Visfatin/NAMPT Antibody (NBP2-46755)

View related products by pathway.

PTMs for PBEF/Visfatin/NAMPT Antibody (NBP2-46755)

Learn more about PTMs related to PBEF/Visfatin/NAMPT Antibody (NBP2-46755).
 

Research Areas for PBEF/Visfatin/NAMPT Antibody (NBP2-46755)

Find related products by research area.

Blogs on PBEF/Visfatin/NAMPT

There are no specific blogs for PBEF/Visfatin/NAMPT, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PBEF/Visfatin/NAMPT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NAMPT
Entrez
Uniprot