Pax2 Antibody (3C7)

Western Blot: Pax2 Antibody (3C7) [H00005076-M01] - Analysis of PAX2 expression in transfected 293T cell line by PAX2 monoclonal antibody (M01), clone 3C7.Lane 1: PAX2 transfected lysate(47.41 KDa).Lane 2: Non-transfected lysate.

Immunohistochemistry-Paraffin: Pax2 Antibody (3C7) [H00005076-M01] - Analysis of monoclonal antibody to PAX2 on formalin-fixed paraffin-embedded human adrenal gland. Antibody concentration 0.5 ug/ml.

ELISA: Pax2 Antibody (3C7) [H00005076-M01] - Detection limit for recombinant GST tagged PAX2 is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
• Clone: 3C7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

Pax2 Antibody (3C7) Summary

• Immunogen: PAX2 (NP_000269, 194 a.a. ~ 303 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PRSNGEKRKRDEDVSEGSVPNGDSQSGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSGTQTYP
• Specificity: PAX2 - paired box gene 2
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PAX2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: GST tag alone is used as a negative control. ICC/IF usage reported in scientific literature (PMID: 23995685).

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 29370269).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Pax2 Antibody (3C7)

• paired box 2
• paired box gene 2
• paired box homeotic gene 2
• paired box protein Pax-2
• Pax2

Background

PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Pax2 Antibody (H00005076-M01)(11)

Publications using H00005076-M01

• Wang X, Fan W, Xu Z et al. SOX2-positive retinal stem cells are identified in adult human pars plicata by single-cell transcriptomic analyses MedComm 2023-02-01 [PMID: 36582303] (ICC/IF)
• Wang Y, Wang L, Zhu Y, Qin J. Human brain organoid-on-a-chip to model prenatal nicotine exposure. Lab Chip 2018-03-13 [PMID: 29437173] (Human)
• Patel D, Shimomura A, Majumdar S et al. The histone demethylase LSD1 regulates inner ear progenitor differentiation through interactions with Pax2 and the NuRD repressor complex. PLoS One 2018-01-25 [PMID: 29370269] (WB, Mouse)
• Zhu Y, Wang L, Yu H et al. In situ generation of human brain organoids on a micropillar array. Lab Chip 2017-07-28 [PMID: 28752164]
• Vinci L, Ravarino A, Fanos V et al. Immunohistochemical markers of neural progenitor cells in the early embryonic human cerebral cortex. Eur J Histochem 2016-02-01 [PMID: 26972711]
• Lancaster MA, Renner M, Martin CA et al. Cerebral organoids model human brain development and microcephaly. Nature 2013-09-19 [PMID: 23995685] (ICC/IF)
• Koehler KR, Mikosz AM, Molosh AI et al. Generation of inner ear sensory epithelia from pluripotent stem cells in 3D culture. Nature. 2013-07-10 [PMID: 23842490]
• Bains OS, Grigliatti TA, Reid RE, Riggs KW. Naturally occurring variants of human aldo-keto reductases with reduced in vitro metabolism of daunorubicin and doxorubicin. J Pharmacol Exp Ther. 2010-09-13 [PMID: 20837989]
• Muguruma K, Nishiyama A, Ono Y et al. Ontogeny-recapitulating generation and tissue integration of ES cell-derived Purkinje cells. Nat Neurosci. 2010-09-12 [PMID: 20835252]
• Knoblich J, Lancester MA., et al. Three Dimensional Heterogeneously Differentiated Tissue Culture. United States Patent Application 2015-11-19
• Zhu Y, Wang L, Yin F et al. Probing impaired neurogenesis in human brain organoids exposed to alcohol. Integr Biol (Camb) 2017-12-11 [PMID: 29168871]

Bioinformatics

• Gene Symbol: PAX2
• Entrez:
  • 5076(Human)
• OMIM:
  • 120330(Human)
• Uniprot:
  • NP_000269(Human)