Pax2 Antibody (3C7)

Images

 
Western Blot: Pax2 Antibody (3C7) [H00005076-M01] - Analysis of PAX2 expression in transfected 293T cell line by PAX2 monoclonal antibody (M01), clone 3C7.Lane 1: PAX2 transfected lysate(47.41 KDa).Lane 2: ...read more
Immunohistochemistry-Paraffin: Pax2 Antibody (3C7) [H00005076-M01] - Analysis of monoclonal antibody to PAX2 on formalin-fixed paraffin-embedded human adrenal gland. Antibody concentration 0.5 ug/ml.
ELISA: Pax2 Antibody (3C7) [H00005076-M01] - Detection limit for recombinant GST tagged PAX2 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clone
3C7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Pax2 Antibody (3C7) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
PAX2 (NP_000269, 194 a.a. ~ 303 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PRSNGEKRKRDEDVSEGSVPNGDSQSGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSGTQTYP
Specificity
PAX2 - paired box gene 2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PAX2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
GST tag alone is used as a negative control. ICC/IF usage reported in scientific literature (PMID: 23995685).
Publications
Read Publications using
H00005076-M01 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 29370269).

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Pax2 Antibody (3C7)

  • paired box 2
  • paired box gene 2
  • paired box homeotic gene 2
  • paired box protein Pax-2
  • Pax2

Background

PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Pax2 Antibody (H00005076-M01)(17)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(2)
WB
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species
Showing Publications 1 - 10 of 17. Show All 17 Publications.
Publications using H00005076-M01 Applications Species
Wang X, Fan W, Xu Z et al. SOX2-positive retinal stem cells are identified in adult human pars plicata by single-cell transcriptomic analyses MedComm 2023-02-01 [PMID: 36582303] (ICC/IF) ICC/IF
Yaqing W, Li W, Yaqiong G et al. Engineering stem cell-derived 3D brain organoids in a perfusable organ-on-a-chip system. RSC Adv. 2018-01-05 [PMID: 35540867]
Knoblich J, Lancester MA., et al. Three Dimensional Heterogeneously Differentiated Tissue Culture. United States Patent Application 2015-11-19
Shota O, Honoka I, Ayano S et al. Generation of two induced pluripotent stem cell lines from individuals without auditory disorders. Stem Cell Res. 2023-01-04 [PMID: 36630839]
Kazuhiko B, Makoto K, Haruki N et al. Upregulation of the hypothalamo-neurohypophysial system and activation of vasopressin neurones attenuates hyperalgesia in a neuropathic pain model rat. Sci Rep. 2022-08-05 [PMID: 35906406]
Kangli C, Yaqing W, Yujuan Z et al. Neurodevelopmental impairment induced by prenatal valproic acid exposure shown with the human cortical organoid-on-a-chip model. Microsyst Nanoeng. 2020-07-13 [PMID: 34567661]
Yasuhito M, Yoichi U, Akinori S et al. Analysis of the proportion and neuronal activity of excitatory and inhibitory neurons in the rat dorsal spinal cord after peripheral nerve injury. Neurosci Lett. 2021-02-15 [PMID: 33600905]
May T, Joao B, Katherine H et al. Ablation of spinal cord estrogen receptor ?-expressing interneurons reduces chemically-induced modalities of pain and itch. J Comp Neurol. 2020-01-06 [PMID: 31872868]
Wang Y, Wang L, Zhu Y, Qin J. Human brain organoid-on-a-chip to model prenatal nicotine exposure. Lab Chip 2018-03-13 [PMID: 29437173] (Human) Human
Patel D, Shimomura A, Majumdar S et al. The histone demethylase LSD1 regulates inner ear progenitor differentiation through interactions with Pax2 and the NuRD repressor complex. PLoS One 2018-01-25 [PMID: 29370269] (WB, Mouse) WB Mouse
Show All 17 Publications.

Reviews for Pax2 Antibody (H00005076-M01) (0)

There are no reviews for Pax2 Antibody (H00005076-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Pax2 Antibody (H00005076-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Pax2 Products

Research Areas for Pax2 Antibody (H00005076-M01)

Find related products by research area.

Blogs on Pax2

There are no specific blogs for Pax2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pax2 Antibody (3C7) and receive a gift card or discount.

Bioinformatics

Gene Symbol PAX2
Entrez
OMIM
Uniprot