Pax2 Antibody (3C7)

Images

 
Western Blot: Pax2 Antibody (3C7) [H00005076-M01] - Analysis of PAX2 expression in transfected 293T cell line by PAX2 monoclonal antibody (M01), clone 3C7.Lane 1: PAX2 transfected lysate(47.41 KDa).Lane 2: ...read more
Immunohistochemistry-Paraffin: Pax2 Antibody (3C7) [H00005076-M01] - Analysis of monoclonal antibody to PAX2 on formalin-fixed paraffin-embedded human adrenal gland. Antibody concentration 0.5 ug/ml.
ELISA: Pax2 Antibody (3C7) [H00005076-M01] - Detection limit for recombinant GST tagged PAX2 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
3C7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Pax2 Antibody (3C7) Summary

Immunogen
PAX2 (NP_000269 194 a.a. - 303 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PRSNGEKRKRDEDVSEGSVPNGDSQSGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSGTQTYP
Specificity
PAX2 - paired box gene 2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PAX2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against recombinant protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. It has been used for IHC-P. ICC/IF usage reported in scientific literature (PMID: 23995685).
Publications
Read Publications using H00005076-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Pax2 Antibody (3C7)

  • paired box 2
  • paired box gene 2
  • paired box homeotic gene 2
  • paired box protein Pax-2
  • Pax2

Background

PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

423-F8/CF
Species: Hu, Mu
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
NBP1-32440
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP, ICC
AF3487
Species: Hu
Applications: WB, IHC, ICC
AF1620
Species: Mu
Applications: WB, IHC
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-01926
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1979
Species: Hu
Applications: WB, Simple Western, ICC
AF482
Species: Mu
Applications: WB, IHC
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00002019-M04
Species: Hu
Applications: WB, ELISA, IHC-P
AF475
Species: Mu
Applications: WB, IHC
NBP2-58069
Species: Hu
Applications: ICC/IF
H00005076-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for Pax2 Antibody (H00005076-M01)(6)

Reviews for Pax2 Antibody (H00005076-M01) (0)

There are no reviews for Pax2 Antibody (H00005076-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Pax2 Antibody (H00005076-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Pax2 Products

Bioinformatics Tool for Pax2 Antibody (H00005076-M01)

Discover related pathways, diseases and genes to Pax2 Antibody (H00005076-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pax2 Antibody (H00005076-M01)

Discover more about diseases related to Pax2 Antibody (H00005076-M01).
 

Pathways for Pax2 Antibody (H00005076-M01)

View related products by pathway.

PTMs for Pax2 Antibody (H00005076-M01)

Learn more about PTMs related to Pax2 Antibody (H00005076-M01).
 

Research Areas for Pax2 Antibody (H00005076-M01)

Find related products by research area.

Blogs on Pax2

There are no specific blogs for Pax2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pax2 Antibody (3C7) and receive a gift card or discount.

Bioinformatics

Gene Symbol PAX2
Entrez
OMIM
Uniprot