PARP7 Antibody


Western Blot: PARP7 Antibody [NBP1-55363] - Titration: 0.2-1 ug/ml, Positive Control: Human heart.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

PARP7 Antibody Summary

Synthetic peptides corresponding to TIPARP(TCDD-inducible poly(ADP-ribose) polymerase) The peptide sequence was selected from the N terminal of TIPARP. Peptide sequence LKTCFKKKDQKRLGTGTLRSLRPILNTLLESGSLDGVFRSRNQSTDENSL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TIPARP and was validated on Western blot.
Theoretical MW
76 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PARP7 Antibody

  • DDF1
  • DKFZP434J214
  • DKFZp686N0351
  • DKFZp686P1838
  • EC
  • FLJ40466
  • PARP-1
  • PARP-7
  • PARP7DKFZp434J214
  • pART14
  • Poly [ADP-ribose] polymerase 7
  • RM1
  • TCDD-inducible poly [ADP-ribose] polymerase
  • TCDD-inducible poly(ADP-ribose) polymerase


TIPARP is a poly [ADP-ribose] polymerase using NAD+ as a substrate to transfer ADP-ribose onto glutamic acid residues of a protein acceptor; repeated rounds of ADP-ribosylation leads to the formation of poly(ADPribose) chains on the protein, thereby altering the function of the target protein. TIPARP may play a role in the adaptative response to chemical exposure (TCDD) and thereby mediates certain effects of the chemicals.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC-P
Species: Mu
Applications: WB
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ca
Applications: WB, ICC/IF, IHC-P, ICC
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Pm
Applications: WB, IHC, IHC-P

Publications for PARP7 Antibody (NBP1-55363) (0)

There are no publications for PARP7 Antibody (NBP1-55363).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PARP7 Antibody (NBP1-55363) (0)

There are no reviews for PARP7 Antibody (NBP1-55363). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PARP7 Antibody (NBP1-55363) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for PARP7 Antibody (NBP1-55363)

Discover related pathways, diseases and genes to PARP7 Antibody (NBP1-55363). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PARP7 Antibody (NBP1-55363)

Discover more about diseases related to PARP7 Antibody (NBP1-55363).

Pathways for PARP7 Antibody (NBP1-55363)

View related products by pathway.

PTMs for PARP7 Antibody (NBP1-55363)

Learn more about PTMs related to PARP7 Antibody (NBP1-55363).

Research Areas for PARP7 Antibody (NBP1-55363)

Find related products by research area.

Blogs on PARP7

There are no specific blogs for PARP7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PARP7 Antibody and receive a gift card or discount.


Gene Symbol TIPARP