PARP7 Antibody

Images

 
Western Blot: PARP7 Antibody [NBP1-55363] - Titration: 0.2-1 ug/ml, Positive Control: Human heart.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PARP7 Antibody Summary

Immunogen
Synthetic peptides corresponding to TIPARP(TCDD-inducible poly(ADP-ribose) polymerase) The peptide sequence was selected from the N terminal of TIPARP. Peptide sequence LKTCFKKKDQKRLGTGTLRSLRPILNTLLESGSLDGVFRSRNQSTDENSL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TIPARP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TIPARP and was validated on Western blot.
Theoretical MW
76 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PARP7 Antibody

  • DDF1
  • DKFZP434J214
  • DKFZp686N0351
  • DKFZp686P1838
  • EC 2.4.2.30
  • FLJ40466
  • PARP-1
  • PARP-7
  • PARP7DKFZp434J214
  • pART14
  • Poly [ADP-ribose] polymerase 7
  • RM1
  • TCDD-inducible poly [ADP-ribose] polymerase
  • TCDD-inducible poly(ADP-ribose) polymerase

Background

TIPARP is a poly [ADP-ribose] polymerase using NAD+ as a substrate to transfer ADP-ribose onto glutamic acid residues of a protein acceptor; repeated rounds of ADP-ribosylation leads to the formation of poly(ADPribose) chains on the protein, thereby altering the function of the target protein. TIPARP may play a role in the adaptative response to chemical exposure (TCDD) and thereby mediates certain effects of the chemicals.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24722
Species: Hu
Applications: WB, IHC-P
NBP1-80533
Species: Mu
Applications: WB
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-43728
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
7270-IL/CF
Species: Hu
NBP1-89230
Species: Hu
Applications: WB, IHC, IHC-P
NB200-209
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-04611
Species: Hu
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-75610
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NLS54
Species: Hu, Mu, Ca
Applications: WB, ICC/IF, IHC-P, ICC
NB100-56563
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-55363
Species: Hu
Applications: WB

Publications for PARP7 Antibody (NBP1-55363) (0)

There are no publications for PARP7 Antibody (NBP1-55363).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PARP7 Antibody (NBP1-55363) (0)

There are no reviews for PARP7 Antibody (NBP1-55363). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PARP7 Antibody (NBP1-55363) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PARP7 Antibody (NBP1-55363)

Discover related pathways, diseases and genes to PARP7 Antibody (NBP1-55363). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PARP7 Antibody (NBP1-55363)

Discover more about diseases related to PARP7 Antibody (NBP1-55363).
 

Pathways for PARP7 Antibody (NBP1-55363)

View related products by pathway.

PTMs for PARP7 Antibody (NBP1-55363)

Learn more about PTMs related to PARP7 Antibody (NBP1-55363).
 

Research Areas for PARP7 Antibody (NBP1-55363)

Find related products by research area.

Blogs on PARP7

There are no specific blogs for PARP7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PARP7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TIPARP
Uniprot