SCIN Antibody

Images

 
Western Blot: SCIN Antibody [NBP1-89230] - Analysis in human cell line SK-BR-3.
Immunohistochemistry-Paraffin: SCIN Antibody [NBP1-89230] - Staining of human kidney shows strong cytoplasmic positivity in a subset of renal tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SCIN Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LKANQVATGIRYNERKGRSELIVVEEGSEPSELIKVLGEKPELPDGGDDDDIIADISNRKMAKLYMVSDASGSMRVTVVAEENPFSMAMLLSEECFILDHG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCIN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SCIN Protein (NBP1-89230PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-89230 in the following applications:

Reactivity Notes

Rat (87%), Mouse (87%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SCIN Antibody

  • KIAA1905adseverin
  • Scinderin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-34118
Species: Hu
Applications: IHC, IHC-P
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-31733
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
1705-HH/CF
Species: Hu, Mu
NBP1-90363
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
409-ML/CF
Species: Mu
NBP1-88026
Species: Hu
Applications: IHC, IHC-P
NBP2-45889
Species: Hu
Applications: WB, IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00064151-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF4779
Species: Hu
Applications: WB, IHC
NB120-11867
Species: Hu
Applications: WB, Flow, Func, IHC, IHC-P
NBP1-89230
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SCIN Antibody (NBP1-89230) (0)

There are no publications for SCIN Antibody (NBP1-89230).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for SCIN Antibody (NBP1-89230) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-89230:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot SCIN NBP1-89230
Enlarge
reviewed by:
Anonymous
WB Mouse 10/07/2016
View

Summary

ApplicationWestern Blot
Sample TestedCD4 T cells cultured in vitro, stimulated with anti-CD3/anti-CD28
SpeciesMouse
LotA96665

Comments

Commentsdilution 1:1000

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCIN Antibody (NBP1-89230) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SCIN Products

Bioinformatics Tool for SCIN Antibody (NBP1-89230)

Discover related pathways, diseases and genes to SCIN Antibody (NBP1-89230). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCIN Antibody (NBP1-89230)

Discover more about diseases related to SCIN Antibody (NBP1-89230).
 

Pathways for SCIN Antibody (NBP1-89230)

View related products by pathway.

PTMs for SCIN Antibody (NBP1-89230)

Learn more about PTMs related to SCIN Antibody (NBP1-89230).
 

Research Areas for SCIN Antibody (NBP1-89230)

Find related products by research area.

Blogs on SCIN

There are no specific blogs for SCIN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
10/07/2016
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol SCIN