PARP4 Antibody

Images

 
Western Blot: PARP4 Antibody [NBP1-89232] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: PARP4 Antibody [NBP1-89232] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: PARP4 Antibody [NBP1-89232] - Staining of human adrenal gland shows strong nuclear and cytoplasmic positivity in cortical cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PARP4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ALLLEEVMNSSTLSQEVSDLVEMIWAEALGHLEHMLLKPVNRISLNDVSKAEGILLLVKAALKNGETAEQLQKMMTEFYRLIPHKGTMPKEVNLGLLAKKADLCQLIRDMVNVCETNLSKPNPPSLAKYRALRCKIEHVEQNTEEF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PARP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PARP4 Protein (NBP1-89232PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PARP4 Antibody

  • 193 kDa vault protein
  • ADP-ribosyltransferase (NAD+; poly (ADP-ribose) polymerase)-like 1
  • ADPRTL1I-alpha-I-related
  • EC 2.4.2.30
  • H5 proline-rich
  • p193
  • PARP-4
  • PARPL
  • PARP-related
  • PARP-related/IalphaI-related H5/proline-rich
  • PH5P
  • poly (ADP-ribose) polymerase family, member 4
  • poly [ADP-ribose] polymerase 4
  • poly(ADP-ribose) synthetase
  • poly(ADP-ribosyl)transferase-like 1
  • Vault poly(ADP-ribose) polymerase
  • vault protein, 193-kDa
  • VAULT3
  • von Willebrand factor A domain containing 5C
  • VPARPKIAA0177
  • VWA5C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33560
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77285
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-76917
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-69565
Species: Hu
Applications: WB, IHC, IHC-P
796-IC
Species: Mu
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt

Publications for PARP4 Antibody (NBP1-89232) (0)

There are no publications for PARP4 Antibody (NBP1-89232).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PARP4 Antibody (NBP1-89232) (0)

There are no reviews for PARP4 Antibody (NBP1-89232). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PARP4 Antibody (NBP1-89232) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PARP4 Products

Bioinformatics Tool for PARP4 Antibody (NBP1-89232)

Discover related pathways, diseases and genes to PARP4 Antibody (NBP1-89232). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PARP4 Antibody (NBP1-89232)

Discover more about diseases related to PARP4 Antibody (NBP1-89232).
 

Pathways for PARP4 Antibody (NBP1-89232)

View related products by pathway.

Research Areas for PARP4 Antibody (NBP1-89232)

Find related products by research area.

Blogs on PARP4

There are no specific blogs for PARP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PARP4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PARP4