PARP2 Antibody - BSA Free

Western Blot: PARP2 Antibody [NBP3-35672] - Western blot analysis of various lysates using PARP2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.

• Reactivity: Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PARP2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PARP2 Antibody - BSA Free (NBP3-35672) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 450-550 of human PARP2 (NP_001036083.1).
  
  Sequence:
  FADMSSKSANYCFASRLKNTGLLLLSEVALGQCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHFVTLNGSTVPLGPASDTGILNPDGYTLNYNEYIVYN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PARP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 66 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for PARP2 Antibody - BSA Free

• ADP-ribosyltransferase (NAD+; poly(ADP-ribose) polymerase)-like 2
• ADPRT2
• ADPRT-2
• ADPRT2pADPRT-2
• ADPRTL2
• ADPRTL2EC 2.4.2.30
• ADPRTL3
• ARTD2
• EC 2.4.2.30
• hPARP-2
• NAD(+) ADP-ribosyltransferase 2
• pADPRT-2
• PARP2
• PARP-2
• poly (ADP-ribose) polymerase 2
• poly (ADP-ribose) polymerase family, member 2
• poly (ADP-ribosyl) transferase-like 2
• poly [ADP-ribose] polymerase 2
• poly(ADP-ribose) synthetase
• Poly[ADP-ribose] synthase 2
• poly[ADP-ribose] synthetase 2

Background

PARP2 encodes poly(ADP-ribosyl)transferase-like 2 protein, which contains a catalytic domain and is capable of catalyzing a poly(ADP-ribosyl)ation reaction. This protein has a catalytic domain which is homologous to that of poly (ADP-ribosyl) transferase, but lacks an N-terminal DNA binding domain which activates the C-terminal catalytic domain of poly (ADP-ribosyl) transferase. The basic residues within the N-terminal region of this protein may bear potential DNA-binding properties, and may be involved in the nuclear and/or nucleolar targeting of the protein. Two alternatively spliced transcript variants encoding distinct isoforms have been found.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PARP2