PARP2 Antibody - BSA Free

Western Blot: PARP2 Antibody [NBP1-54680] - Reccomended Titration: 0.2 - 1 ug/ml Positive Control: Raji cell lysate PARP2 is strongly supported by BioGPS gene expression data to be expressed in Human Raji cells

Immunocytochemistry/Immunofluorescence: PARP2 Antibody [NBP1-54680] - Rat thyrocytes-FRTL-5 Primary Antibody Dilution: 1 : 100 Secondary Antibody: Anti-rabbit-Texas Red Secondary Antibody Dilution: 1 : 100 Color/Signal Descriptions: Red: PARP2Blue: DAPI Gene name: PARP2 Submitted by: Syed A Morshed, Mount Sinai School of Medicine and James J Peters VA Medical Center.

Western Blot: PARP2 Antibody [NBP1-54680] - Sample Tissue: Human Hela Antibody Dilution: 1.0 ug/ml

• Reactivity: Hu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PARP2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to PARP2 (poly (ADP-ribose) polymerase family, member 2) The peptide sequence was selected from the middle region of PARP2. Peptide sequence LLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEA. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PARP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1.0 ug/ml
• Theoretical MW: 61 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PARP2 Antibody - BSA Free

• ADP-ribosyltransferase (NAD+; poly(ADP-ribose) polymerase)-like 2
• ADPRT2
• ADPRT-2
• ADPRT2pADPRT-2
• ADPRTL2
• ADPRTL2EC 2.4.2.30
• ADPRTL3
• ARTD2
• EC 2.4.2.30
• hPARP-2
• NAD(+) ADP-ribosyltransferase 2
• pADPRT-2
• PARP2
• PARP-2
• poly (ADP-ribose) polymerase 2
• poly (ADP-ribose) polymerase family, member 2
• poly (ADP-ribosyl) transferase-like 2
• poly [ADP-ribose] polymerase 2
• poly(ADP-ribose) synthetase
• Poly[ADP-ribose] synthase 2
• poly[ADP-ribose] synthetase 2

Background

PARP2 contains a catalytic domain and is capable of catalyzing a poly(ADP-ribosyl)ation reaction. This protein has a catalytic domain which is homologous to that of poly (ADP-ribosyl) transferase, but lacks an N-terminal DNA binding domain which activates the C-terminal catalytic domain of poly (ADP-ribosyl) transferase. The basic residues within the N-terminal region of this protein may bear potential DNA-binding properties, and may be involved in the nuclear and/or nucleolar targeting of protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PARP2
• Uniprot:
  • Q9UGN5(Human)