Parkin Antibody


Western Blot: Parkin Antibody [NBP1-80515] - Mouse Liver lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity MuSpecies Glossary
Applications WB
Please see the vial label for concentration. If unlisted please contact technical services.

Order Details

Parkin Antibody Summary

Synthetic peptide directed towards amino acids 311-360 of the mouse Park2. Peptide sequence YTRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEQGQRKVTCEGGNGLGCG.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against Park2 and was validated on Western blot.


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Parkin Antibody

  • AR-JP
  • E3 ubiquitin ligase
  • E3 ubiquitin-protein ligase parkin
  • EC 6.3.2.-
  • LPRS2
  • PARK2
  • parkin 2
  • parkin
  • Parkinson disease protein 2
  • Parkinson juvenile disease protein 2
  • parkinson protein 2, E3 ubiquitin protein ligase (parkin)
  • PDJ
  • PDJjuvenile) 2, parkin
  • PRKN


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, PEP-ELISA
Species: Hu, Mu, Rt, Ch
Applications: WB, Simple Western, ICC/IF, IP, In vitro
Species: Hu, Mu, Bv, Ce
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Ze
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICFlow
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Dr, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
Species: Hu, Mu
Applications: WB, Simple Western, IHC
Species: Hu, Rt
Applications: WB, ELISA

Publications for Parkin Antibody (NBP1-80515) (0)

There are no publications for Parkin Antibody (NBP1-80515).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Parkin Antibody (NBP1-80515) (0)

There are no reviews for Parkin Antibody (NBP1-80515). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Parkin Antibody (NBP1-80515) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Parkin Antibody Products

Related Products by Gene

Bioinformatics Tool for Parkin Antibody (NBP1-80515)

Discover related pathways, diseases and genes to Parkin Antibody (NBP1-80515). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Parkin Antibody (NBP1-80515)

Discover more about diseases related to Parkin Antibody (NBP1-80515).

Pathways for Parkin Antibody (NBP1-80515)

View related products by pathway.

PTMs for Parkin Antibody (NBP1-80515)

Learn more about PTMs related to Parkin Antibody (NBP1-80515).

Blogs on Parkin.

Parkin - Role in Mitochondrial Quality Control and Parkinson's Disease
Parkin/PARK2 is a cytosolic enzyme which gets recruited to cellular mitochondria damaged through depolarization, ROS or unfolded proteins accumulation, and exert protective effects by inducing mitophagy (mitochondrial autophagy). Parkin induces mit...  Read full blog post.

PINK1 - performing mitochondrial quality control and protecting against Parkinson’s disease
PTEN-induced putative kinase 1 (PINK1) is a serine/threonine kinase with important functions in mitochondrial quality control. Together with the Parkin protein, PINK1 is able to regulate the selective degradation of damaged mitochondria through aut...  Read full blog post.

PINK1: All work and no fun
The protein PINK1 is a mitochondrial-located serine/threonine kinase (PTK) that maintains organelle function and integrity. It not only protects organelles from cellular stress, but it also uses the selective auto-phagocytosis process for cleaning and...  Read full blog post.

PINK1: Promoting Organelle Stability and Preventing Parkinson's disease
PINK1 is a protein serine/threonine kinase (PTK) that protects the organelles from cellular stress and controls selective autophagy to clear damage. Exner, et al. were among the first to report that PINK1 deficiency in humans was linked to autosomal r...  Read full blog post.

Novus Antibodies Highlighted in Parkinson's Disease Research
Identified almost two centuries ago, Parkinson's disease is a neurodegenerative disorder that afflicts an estimated 4-6 million worldwide ( The prevalence of Parkinson's disease is expected to grow considerably as the average age o...  Read full blog post.

Contact Information

Product PDFs


Gene Symbol PARK2

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-80515 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought