PARD6A Antibody

Images

 
Western Blot: PARD6A Antibody [NBP2-38487] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunocytochemistry/ Immunofluorescence: PARD6A Antibody [NBP2-38487] - Staining of human cell line MCF7 shows localization to actin filaments & cell junctions.
Immunohistochemistry-Paraffin: PARD6A Antibody [NBP2-38487] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PARD6A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DLVIENRQPPSSNGLSQGPPCWDLHPGCRHPGTRSSLPSLDDQEQASSGWGSRIRGDGSGFS
Specificity
Specificity of human PARD6A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PARD6A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PARD6A Protein (NBP2-38487PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PARD6A Antibody

  • PAR-6 alpha
  • par-6 partitioning defective 6 homolog alpha (C. elegans)
  • PAR-6
  • PAR6A
  • PAR6alpha
  • PAR-6Apar-6 (partitioning defective 6, C.elegans) homolog alpha
  • PAR6C
  • partitioning defective 6 homolog alpha
  • partitioning defective-6 homolog alpha
  • partitioning-defective protein 6
  • Tax interaction protein 40
  • TAX40
  • Tax-interacting protein 40
  • TIP-40PAR6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88861
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NLS261
Species: Hu
Applications: WB (-), IHC-P, ICC
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-61816
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-81746
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P
AF7979
Species: Hu, Mu, Rt
Applications: WB
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NB100-1354
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00057154-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-79833
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38487
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PARD6A Antibody (NBP2-38487) (0)

There are no publications for PARD6A Antibody (NBP2-38487).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PARD6A Antibody (NBP2-38487) (0)

There are no reviews for PARD6A Antibody (NBP2-38487). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PARD6A Antibody (NBP2-38487) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PARD6A Antibody (NBP2-38487)

Discover related pathways, diseases and genes to PARD6A Antibody (NBP2-38487). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PARD6A Antibody (NBP2-38487)

Discover more about diseases related to PARD6A Antibody (NBP2-38487).
 

Pathways for PARD6A Antibody (NBP2-38487)

View related products by pathway.

PTMs for PARD6A Antibody (NBP2-38487)

Learn more about PTMs related to PARD6A Antibody (NBP2-38487).
 

Research Areas for PARD6A Antibody (NBP2-38487)

Find related products by research area.

Blogs on PARD6A

There are no specific blogs for PARD6A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PARD6A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PARD6A
Uniprot