SMURF1 Antibody (1D7)

Images

 
Western Blot: SMURF1 Antibody (1D7) [H00057154-M01] - SMURF1 monoclonal antibody (M01), clone 1D7. Analysis of SMURF1 expression in HepG2.
Immunocytochemistry/ Immunofluorescence: SMURF1 Antibody (1D7) [H00057154-M01] - Analysis of monoclonal antibody to SMURF1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: SMURF1 Antibody (1D7) [H00057154-M01] - Analysis of monoclonal antibody to SMURF1 on formalin-fixed paraffin-embedded human stomach. Antibody concentration 2 ug/ml.
Western Blot: SMURF1 Antibody (1D7) [H00057154-M01] - SMURF1 expression in Raw 264.7 ( Cat # L024V1 ).
Western Blot: SMURF1 Antibody (1D7) [H00057154-M01] - SMURF1 expression in NIH/3T3 ( Cat # L018V1 ).
Western Blot: SMURF1 Antibody (1D7) [H00057154-M01] - SMURF1 monoclonal antibody (M01), clone 1D7. Analysis of SMURF1 expression in HeLa.
Western Blot: SMURF1 Antibody (1D7) [H00057154-M01] - Analysis of SMURF1 expression in transfected 293T cell line by SMURF1 monoclonal antibody (M01), clone 1D7.Lane 1: SMURF1 transfected lysate(83.4 KDa).Lane 2: ...read more
Immunoprecipitation: SMURF1 Antibody (1D7) [H00057154-M01] - Analysis of SMURF1 transfected lysate using anti-SMURF1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SMURF1 MaxPab rabbit ...read more
ELISA: SMURF1 Antibody (1D7) [H00057154-M01] - Detection limit for recombinant GST tagged SMURF1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IP
Clone
1D7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SMURF1 Antibody (1D7) Summary

Immunogen
SMURF1 (NP_065162, 165 a.a. ~ 268 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIP
Specificity
SMURF1 (1D7)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SMURF1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Immunoprecipitation 1:10-1:500
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
Publications
Read Publications using
H00057154-M01 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SMURF1 Antibody (1D7)

  • E3 ubiquitin ligase SMURF1
  • EC 6.3.2
  • EC 6.3.2.-
  • hSMURF1
  • KIAA1625
  • KIAA1625E3 ubiquitin-protein ligase SMURF1
  • SMAD specific E3 ubiquitin protein ligase 1
  • SMAD ubiquitination regulatory factor 1
  • Smad-specific E3 ubiquitin ligase 1
  • SMAD-specific E3 ubiquitin-protein ligase 1
  • SMURF1

Background

This gene encodes a ubiquitin ligase that is specific for receptor-regulated SMAD proteins in the bone morphogenetic protein (BMP) pathway. A similar protein in Xenopus is involved in embryonic pattern formation. Alternative splicing results in multiple transcript variants encoding different isoforms. An additional transcript variant has been identified, but its full length sequence has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SMURF1 Antibody (H00057154-M01)(7)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 3 applications: ICC/IF, IF/IHC, WB.


Filter By Application
ICC/IF
(1)
IF/IHC
(1)
WB
(2)
All Applications
Filter By Species
Human
(1)
Mouse
(2)
All Species

Reviews for SMURF1 Antibody (H00057154-M01) (0)

There are no reviews for SMURF1 Antibody (H00057154-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SMURF1 Antibody (H00057154-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SMURF1 Products

Research Areas for SMURF1 Antibody (H00057154-M01)

Find related products by research area.

Blogs on SMURF1

There are no specific blogs for SMURF1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMURF1 Antibody (1D7) and receive a gift card or discount.

Bioinformatics

Gene Symbol SMURF1
Entrez
OMIM
Uniprot