Recombinant Human GPR172B Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GPR172B Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-448 of Human GPR172B full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAAPTLGRLVLTHLLVALFGMGSWAAVNGIWVELPVVVKDLPEGWSLPSYLSVVVALGNLGLLVVTLWRRLAPGKGEQVPIQVVQVLSVVGTALLAPLWHHVAPVAGQLHSVAFLTLALVLAMACCTSNVTFLPFLSHLPPPFLRSFFLGQGLSALLPCVLALVQGVGRLECPPAPTNGTSGPPLDFPERFPASTFFWALTALLVTSAAAFRGLLLLLPSLPSVTTGGSGPELQLGSPGAEEEEKEEEEALPLQEPPSQAAGTIPGPDPEVHQLFSAHGAFLLGLMAFTSAVTNGVLPSVQSFSCLPYGRLAYHLAVVLGSAANPLACFLAMGVLCRSLAGLVGLSLLGMLFGAYLMALAILSPCPPLVGTTAGVVLVVLSWVLCLCVFSYVKVAASSLLHGGGRPALLAAGVAIQVGSLLGAGAMFPPTSIYHVFQSRKDCVDPCGP

Protein/Peptide Type
Recombinant Protein
Gene
SLC52A1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GPR172B Protein

  • FLJ10060riboflavin transporter 1
  • G protein-coupled receptor 172B
  • GPCR42Protein GPR172B
  • hRFT1G-protein coupled receptor GPCR42
  • PAR2PERV-A receptor 2
  • Porcine endogenous retrovirus A receptor 2
  • RFT1

Background

GPCR41 (MIM 607882) and GPCR42 act as receptors for porcine endogenous retrovirus subgroup A (PERV-A).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-49382
Species: Hu
Applications: IHC
MAB3949
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-81746
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
H00009002-M01
Species: Hu
Applications: WB, ELISA
NBP1-87338
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NLS261
Species: Hu
Applications: WB (-), IHC-P, ICC
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP1-88861
Species: Hu, Mu
Applications: Simple Western, ICC/IF, IHC, IHC-P
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP2-01679
Species: Hu
Applications: WB, Flow, IHC, IHC-P

Publications for GPR172B Recombinant Protein (H00055065-P01) (0)

There are no publications for GPR172B Recombinant Protein (H00055065-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR172B Recombinant Protein (H00055065-P01) (0)

There are no reviews for GPR172B Recombinant Protein (H00055065-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPR172B Recombinant Protein (H00055065-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GPR172B Products

Bioinformatics Tool for GPR172B Recombinant Protein (H00055065-P01)

Discover related pathways, diseases and genes to GPR172B Recombinant Protein (H00055065-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR172B Recombinant Protein (H00055065-P01)

Discover more about diseases related to GPR172B Recombinant Protein (H00055065-P01).
 

Pathways for GPR172B Recombinant Protein (H00055065-P01)

View related products by pathway.

Blogs on GPR172B

There are no specific blogs for GPR172B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GPR172B Antibody
19540002-0.1mg

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GPR172B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC52A1