GPSM2 Antibody

Images

 
Western Blot: GPSM2 Antibody [NBP1-53125] - Sample Tissue: Human Lung Tumor Antibody Dilution: 1.0 ug/ml
Immunocytochemistry/ Immunofluorescence: GPSM2 Antibody [NBP1-53125] - Human cell lines.
Immunohistochemistry: GPSM2 Antibody [NBP1-53125] - Paraffin Embedded Tissue: Human Liver Antibody Concentration: 5 ug/ml
Western Blot: GPSM2 Antibody [NBP1-53125] - Human Fetal Liver Lysate, concentration 1ug/ml.
Immunohistochemistry-Paraffin: GPSM2 Antibody [NBP1-53125] - Human Placenta.
Immunohistochemistry: GPSM2 Antibody [NBP1-53125] - Analysis of human liver after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPSM2 Antibody Summary

Immunogen
Synthetic peptides corresponding to GPSM2(G-protein signaling modulator 2 (AGS3-like, C. elegans)) The peptide sequence was selected from the N terminal of GPSM2 (NP_037428). Peptide sequence YFYLHDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPSM2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against GPSM2 and was validated on Western blot.
Theoretical MW
76 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GPSM2 Antibody

  • deafness, autosomal recessive 82
  • DFNB82
  • G-protein signaling modulator 2
  • G-protein signalling modulator 2 (AGS3-like, C. elegans)
  • G-protein-signaling modulator 2
  • LGNPins
  • Mosaic protein LGN
  • PINS

Background

Heterotrimeric G proteins transduce extracellular signals received by cell surface receptors into integrated cellular responses. GPSM2 belongs to a group of proteins that modulate activation of G proteins.Heterotrimeric G proteins transduce extracellular signals received by cell surface receptors into integrated cellular responses. GPSM2 belongs to a group of proteins that modulate activation of G proteins (Blumer et al., 2002 [PubMed 11832491]).[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
H00028299-P01
Species: Hu
NBP1-86856
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB500-174
Species: Hu, Mu, Rt, Ma, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NB100-233
Species: Hu
Applications: WB, PLA
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF877
Species: Hu
Applications: WB, IHC, IP
NBP1-91968
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-37429
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NBP1-88707
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88861
Species: Hu, Mu
Applications: Simple Western, ICC/IF, IHC, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF

Publications for GPSM2 Antibody (NBP1-53125) (0)

There are no publications for GPSM2 Antibody (NBP1-53125).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPSM2 Antibody (NBP1-53125) (0)

There are no reviews for GPSM2 Antibody (NBP1-53125). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GPSM2 Antibody (NBP1-53125) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPSM2 Products

Bioinformatics Tool for GPSM2 Antibody (NBP1-53125)

Discover related pathways, diseases and genes to GPSM2 Antibody (NBP1-53125). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPSM2 Antibody (NBP1-53125)

Discover more about diseases related to GPSM2 Antibody (NBP1-53125).
 

Pathways for GPSM2 Antibody (NBP1-53125)

View related products by pathway.

PTMs for GPSM2 Antibody (NBP1-53125)

Learn more about PTMs related to GPSM2 Antibody (NBP1-53125).
 

Research Areas for GPSM2 Antibody (NBP1-53125)

Find related products by research area.

Blogs on GPSM2

There are no specific blogs for GPSM2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPSM2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPSM2
Entrez
Uniprot