GPSM2 Antibody


Western Blot: GPSM2 Antibody [NBP1-53125] - Sample Tissue: Human Lung Tumor Antibody Dilution: 1.0 ug/ml
Immunocytochemistry/ Immunofluorescence: GPSM2 Antibody [NBP1-53125] - Human cell lines.
Immunohistochemistry: GPSM2 Antibody [NBP1-53125] - Paraffin Embedded Tissue: Human Liver Antibody Concentration: 5 ug/ml
Western Blot: GPSM2 Antibody [NBP1-53125] - Human Fetal Liver Lysate, concentration 1ug/ml.
Immunohistochemistry-Paraffin: GPSM2 Antibody [NBP1-53125] - Human Placenta.
Immunohistochemistry: GPSM2 Antibody [NBP1-53125] - Analysis of human liver after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

GPSM2 Antibody Summary

Synthetic peptides corresponding to GPSM2(G-protein signaling modulator 2 (AGS3-like, C. elegans)) The peptide sequence was selected from the N terminal of GPSM2 (NP_037428). Peptide sequence YFYLHDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEA. The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against GPSM2 and was validated on Western blot.
Theoretical MW
76 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GPSM2 Antibody

  • deafness, autosomal recessive 82
  • DFNB82
  • G-protein signaling modulator 2
  • G-protein signalling modulator 2 (AGS3-like, C. elegans)
  • G-protein-signaling modulator 2
  • LGNPins
  • Mosaic protein LGN
  • PINS


Heterotrimeric G proteins transduce extracellular signals received by cell surface receptors into integrated cellular responses. GPSM2 belongs to a group of proteins that modulate activation of G proteins.Heterotrimeric G proteins transduce extracellular signals received by cell surface receptors into integrated cellular responses. GPSM2 belongs to a group of proteins that modulate activation of G proteins (Blumer et al., 2002 [PubMed 11832491]).[supplied by OMIM].


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Ma, Mar, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC, IHC-P, WB

Publications for GPSM2 Antibody (NBP1-53125) (0)

There are no publications for GPSM2 Antibody (NBP1-53125).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPSM2 Antibody (NBP1-53125) (0)

There are no reviews for GPSM2 Antibody (NBP1-53125). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GPSM2 Antibody (NBP1-53125) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GPSM2 Products

Bioinformatics Tool for GPSM2 Antibody (NBP1-53125)

Discover related pathways, diseases and genes to GPSM2 Antibody (NBP1-53125). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPSM2 Antibody (NBP1-53125)

Discover more about diseases related to GPSM2 Antibody (NBP1-53125).

Pathways for GPSM2 Antibody (NBP1-53125)

View related products by pathway.

PTMs for GPSM2 Antibody (NBP1-53125)

Learn more about PTMs related to GPSM2 Antibody (NBP1-53125).

Research Areas for GPSM2 Antibody (NBP1-53125)

Find related products by research area.

Blogs on GPSM2

There are no specific blogs for GPSM2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GPSM2 Antibody and receive a gift card or discount.


Gene Symbol GPSM2