PAPOLG Antibody - BSA Free

Western Blot: PAPOLG Antibody [NBP2-55535] - Western blot analysis in human cell line RT-4.

Immunocytochemistry/Immunofluorescence: PAPOLG Antibody [NBP2-55535] - Staining of human cell line U-2 OS shows localization to nucleoplasm.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PAPOLG Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PAAVIVEKPLSVPPAQGLSIPVIGAKVDSTVKTVSPPTVCTIPTVVGRNVIPRITTPHNPAQGQPHLNGMSNITKT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PAPOLG
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PAPOLG Recombinant Protein Antigen (NBP2-55535PEP)

Reactivity Notes

Mouse 84%, Rat 82%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PAPOLG Antibody - BSA Free

• EC 2.7.7.19
• FLJ11805
• FLJ12972
• FLJ13482
• FLJ14187
• MGC133307
• MGC133308
• neo-PAP
• Neo-poly(A) polymerase
• nuclear poly(A) polymerase gamma
• PAP2
• PAPG
• PAP-gamma
• poly(A) polymerase gamma
• Polynucleotide adenylyltransferase gamma
• SRP RNA 3' adenylating enzyme/pap2
• SRP RNA 3'-adenylating enzyme

Background

PAPOLG is a member of the poly(A) polymerase family which catalyzes template-independent extension of the 3' end of a DNA/RNA strand. This enzyme shares 60% identity to the well characterized poly(A) polymerase II (PAPII) at the amino acid level. These two enzymes have similar organization of structural and functional domains. This enzyme is exclusively localized in the nucleus and exhibits both nonspecific and CPSF (cleavage and polyadenylation specificity factor)/AAUAAA-dependent polyadenylation activity. This gene is located on chromosome 2 in contrast to the PAPII gene, which is located on chromosome 14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PAPOLG