methyltransferase like 9 Antibody

Images

 
Western Blot: methyltransferase like 9 Antibody [NBP2-31564] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line SK-MEL-30
Immunohistochemistry: methyltransferase like 9 Antibody [NBP2-31564] - Staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

methyltransferase like 9 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VILALVLPFHPYVENVGGKWEKPSEILEIKGQNWEEQVNSLPEVFRKAGFVIEAFTRLPYLCEGDMYNDYYVLDDAVFVL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
METTL9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
methyltransferase like 9 Protein (NBP2-31564PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for methyltransferase like 9 Antibody

  • DORA reverse strand protein 1
  • DORA reverse strand protein
  • DREV
  • DREV1methyltransferase-like protein 9
  • FLJ21912
  • methyltransferase like 9
  • p53 activated protein 1
  • PAP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-43679
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45378
Species: Hu
Applications: WB, IHC
NBP1-30061
Species: Hu, Mu
Applications: WB, IP
NB100-61050
Species: Hu
Applications: WB, IHC-P, IP, PLA
MAB6240
Species: Hu
Applications: WB, IHC
NB100-55268
Species: Hu
Applications: WB, IP
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
H00000466-D01P
Species: Hu, Mu, Rt
Applications: WB
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-80306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB110-57150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-79802
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P

Publications for methyltransferase like 9 Antibody (NBP2-31564) (0)

There are no publications for methyltransferase like 9 Antibody (NBP2-31564).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for methyltransferase like 9 Antibody (NBP2-31564) (0)

There are no reviews for methyltransferase like 9 Antibody (NBP2-31564). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for methyltransferase like 9 Antibody (NBP2-31564) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional methyltransferase like 9 Products

Bioinformatics Tool for methyltransferase like 9 Antibody (NBP2-31564)

Discover related pathways, diseases and genes to methyltransferase like 9 Antibody (NBP2-31564). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on methyltransferase like 9

There are no specific blogs for methyltransferase like 9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our methyltransferase like 9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol METTL9
Uniprot