PAPOLG Antibody

Images

 
Western Blot: PAPOLG Antibody [NBP2-55534] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: PAPOLG Antibody [NBP2-55534] - Staining of human cell line U-2 OS shows localization to nucleus.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PAPOLG Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KQLHHYLPAEILQKKKKQSLSDVNRSSGGLQSKRLSLDSSCLDSSRDTDNGTPFNSPASKSDSPSVGETERN
Specificity
Specificity of human PAPOLG antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PAPOLG
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PAPOLG Recombinant Protein Antigen (NBP2-55534PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PAPOLG Antibody

  • EC 2.7.7.19
  • FLJ11805
  • FLJ12972
  • FLJ13482
  • FLJ14187
  • MGC133307
  • MGC133308
  • neo-PAP
  • Neo-poly(A) polymerase
  • nuclear poly(A) polymerase gamma
  • PAP2
  • PAPG
  • PAP-gamma
  • poly(A) polymerase gamma
  • Polynucleotide adenylyltransferase gamma
  • SRP RNA 3' adenylating enzyme/pap2
  • SRP RNA 3'-adenylating enzyme

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-65749
Species: Hu
AF6240
Species: Hu
Applications: WB, ELISA, IHC
NBP2-65899
Species: Hu
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-31564
Species: Hu
Applications: WB, IHC, IHC-P
NB110-57150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
H00005555-P01
Species: Hu
H00005554-R02
Species: Hu
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-80306
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-43686
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PAPOLG Antibody (NBP2-55534) (0)

There are no publications for PAPOLG Antibody (NBP2-55534).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAPOLG Antibody (NBP2-55534) (0)

There are no reviews for PAPOLG Antibody (NBP2-55534). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PAPOLG Antibody (NBP2-55534) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PAPOLG Antibody (NBP2-55534)

Discover related pathways, diseases and genes to PAPOLG Antibody (NBP2-55534). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for PAPOLG Antibody (NBP2-55534)

View related products by pathway.

PTMs for PAPOLG Antibody (NBP2-55534)

Learn more about PTMs related to PAPOLG Antibody (NBP2-55534).

Blogs on PAPOLG

There are no specific blogs for PAPOLG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PAPOLG Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PAPOLG