PALB2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PALB2 Antibody [NBP2-55028] - Staining of human cell line A-431 shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PALB2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YDKLHIKTHLDEETGEKTSITLDVGPESFNPGDGPGGLPIQRTDDTQEHFPHRVSDPSGEQKQKLPSRRKKQQKRTFISQERDCVFGTDSL
Specificity
Specificity of human PALB2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PALB2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PALB2 Recombinant Protein Antigen (NBP2-55028PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PALB2 Antibody

  • DKFZp667I166
  • DKFZp686E1054
  • FANCNFLJ21816
  • partner and localizer of BRCA2
  • PNCA3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88361
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
NBP1-31883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-404
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
NBP1-92139
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56546
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-309
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD
NB100-2564
Species: Hu
Applications: WB
NB100-148
Species: Hu, Mu, Rt, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, KD
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-92672
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-182
Species: Hu, Mu, Rt, Av, Ca, Ma, Pm, Ze
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, RNAi, KD, KO
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5776
Species: Hu
Applications: WB, IHC
NBP2-83949
Species: Hu
Applications: WB
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow, KO
NB100-143
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, ISH, PAGE, KO
NB100-147
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP, In vitro, KD
NB100-56599
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, Flow-IC

Publications for PALB2 Antibody (NBP2-55028) (0)

There are no publications for PALB2 Antibody (NBP2-55028).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PALB2 Antibody (NBP2-55028) (0)

There are no reviews for PALB2 Antibody (NBP2-55028). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PALB2 Antibody (NBP2-55028) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PALB2 Products

Array NBP2-55028

Bioinformatics Tool for PALB2 Antibody (NBP2-55028)

Discover related pathways, diseases and genes to PALB2 Antibody (NBP2-55028). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PALB2 Antibody (NBP2-55028)

Discover more about diseases related to PALB2 Antibody (NBP2-55028).
 

Pathways for PALB2 Antibody (NBP2-55028)

View related products by pathway.

PTMs for PALB2 Antibody (NBP2-55028)

Learn more about PTMs related to PALB2 Antibody (NBP2-55028).
 

Research Areas for PALB2 Antibody (NBP2-55028)

Find related products by research area.

Blogs on PALB2.

The recent relationship of BRCA1 and 53BP1
The p53-binding protein 1 (53BP1) is a DNA damage response factor, which is recruited to nuclear structures at the site of DNA damage.  DNA double-strand breaks (DSBs) are mutations that are detrimental to cell viability and genome stability, and m...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PALB2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PALB2