Recombinant Human BJHCC20A Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human BJHCC20A Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-264 of Human CXorf48 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLRLLRLALAFYGRTADPAERQGPQQQGLPQGDTQLTTVQGVVTSFCGDYGMIDESIYFSSDVVTGNVPLKVGQKVNVVVEEDKPHYGLRAIKVDVVPRHLYGAGPSDSGTRVLIGCVTSINEDNIYISNSIYFSIAIVSEDFVPYKGDLLEVEYSTEPGISNIKATSVKPIRCIHTEEVCITSVHGRNGVIDYTIFFTLDSVKLPDGYVPQVDDIVNVVMVESIQFCFIWRAISITPVHKSSSGFQDDGGLGRPKRERRSQSI

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
CXORF48
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
55.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BJHCC20A Protein

  • BJHCC20A
  • Cancer/testis antigen 55
  • chromosome X open reading frame 48
  • CT55 BRCA2-interacting protein
  • CT55
  • CXorf48
  • FLJ20527
  • RP13-565O16.1
  • Tumor antigen BJ-HCC-20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

21340002
Species: Hu
Applications: WB, ELISA
MAB2476
Species: Hu
Applications: WB, IHC
NBP1-31319
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB100-1334
Species: Hu, Mu, Po, Bv, Ca
Applications: PEP-ELISA
NB100-755
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1894
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-24590
Species: Mu
Applications: WB, IHC-P
NBP1-87832
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-74502
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-88606
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P, KO
NBP1-88927
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00051380-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-545
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB110-40623
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP

Publications for BJHCC20A Recombinant Protein (H00054967-P01) (0)

There are no publications for BJHCC20A Recombinant Protein (H00054967-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BJHCC20A Recombinant Protein (H00054967-P01) (0)

There are no reviews for BJHCC20A Recombinant Protein (H00054967-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BJHCC20A Recombinant Protein (H00054967-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for BJHCC20A Recombinant Protein (H00054967-P01)

Discover related pathways, diseases and genes to BJHCC20A Recombinant Protein (H00054967-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on BJHCC20A

There are no specific blogs for BJHCC20A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BJHCC20A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CXORF48