PAIP1 Antibody


Western Blot: PAIP1 Antibody [NBP2-68963] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunohistochemistry: PAIP1 Antibody [NBP2-68963] - Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

PAIP1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: GTNGQVTRADILQVGLRELLNALFSNPMDDNLICAVKLLKLTGSVLEDAWKEKGKMDMEEIIQRIENVVLDANCSRDVKQMLLK
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
Recommended conditions for IHC,Retrieval method: HIER pH6
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Protein A purified

Alternate Names for PAIP1 Antibody

  • MGC12360
  • PABC1-interacting protein 1
  • PABP-interacting protein 1
  • PAIP-1
  • poly(A) binding protein interacting protein 1
  • Poly(A)-binding protein-interacting protein 1
  • polyadenylate binding protein-interacting protein 1
  • polyadenylate-binding protein-interacting protein 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
Species: Hu, Po
Applications: WB, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ca, Ch, Pm
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Mu
Applications: WB, IP
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for PAIP1 Antibody (NBP2-68963) (0)

There are no publications for PAIP1 Antibody (NBP2-68963).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAIP1 Antibody (NBP2-68963) (0)

There are no reviews for PAIP1 Antibody (NBP2-68963). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PAIP1 Antibody (NBP2-68963) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional PAIP1 Products

Bioinformatics Tool for PAIP1 Antibody (NBP2-68963)

Discover related pathways, diseases and genes to PAIP1 Antibody (NBP2-68963). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PAIP1 Antibody (NBP2-68963)

Discover more about diseases related to PAIP1 Antibody (NBP2-68963).

Pathways for PAIP1 Antibody (NBP2-68963)

View related products by pathway.

PTMs for PAIP1 Antibody (NBP2-68963)

Learn more about PTMs related to PAIP1 Antibody (NBP2-68963).

Blogs on PAIP1

There are no specific blogs for PAIP1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PAIP1 Antibody and receive a gift card or discount.


Gene Symbol PAIP1
COVID-19 update