Orthogonal Strategies: Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90063] - Analysis in human testis and skeletal muscle tissues. Corresponding Ataxin-2 RNA-seq data are presented for the same tissues.
Independent Antibodies: Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90063] - Staining of human cerebellum, cerebral cortex, skeletal muscle and testis using Anti-Ataxin-2 antibody NBP1-90063 (A) shows ...read more
Immunocytochemistry/ Immunofluorescence: Ataxin-2 Antibody [NBP1-90063] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90063] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90063] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90063] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90063] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Western blot analysis in mouse cell line NIH-3T3.
Genetic Strategies: Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1, using Anti-ATXN2 antibody. Remaining relative intensity is presented. Loading control: ...read more
This antibody was developed against Recombinant Protein corresponding to amino acids: TPPAYSTQYVAYSPQQFPNQPLVQHVPHYQSQHPHVYSPVIQGNARMMAPPTHAQPGLVSSSATQYGAHEQTHAMYACPKLPYNKETSPSFYFAISTGSLAQQYAHPNATLHPHTPHPQPSATPTGQQQSQHGGSHPAPS
Predicted Species
Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATXN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Please note that WB is no longer validated for the current lot of this antibody. The publications that cite use of this product in WB were for previous lots. The antibody may work in WB but we do not guarantee it any longer.
The autosomal dominant cerebellar ataxias (ADCA) are a heterogeneous group of neurodegenerative disorders characterized by progressive degeneration of the cerebellum, brain stem and spinal cord. Clinically, ADCA has been divided into three groups: ADCA types I-III. ADCAI is genetically heterogeneous, with five genetic loci, designated spinocerebellar ataxia (SCA) 1, 2, 3, 4 and 6, being assigned to five different chromosomes. ADCAII, which always presents with retinal degeneration (SCA7), and ADCAIII often referred to as the `pure' cerebellar syndrome (SCA5), are most likely homogeneous disorders. Several SCA genes have been cloned and shown to contain CAG repeats in their coding regions. ADCA is caused by the expansion of the CAG repeats, producing an elongated polyglutamine tract in the corresponding protein. The expanded repeats are variable in size and unstable, usually increasing in size when transmitted to successive generations. The function of the ataxins is not known. This locus has been mapped to chromosome 12, and it has been determined that the diseased allele contains 36-52 CAG repeats, compared to 22-23 in the normal allele. A potential transcript variant, missing an internal coding exon, has been described; however, its full-length nature is not certain.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Bioinformatics Tool for Ataxin-2 Antibody (NBP1-90063)
Discover related pathways, diseases and genes to Ataxin-2 Antibody (NBP1-90063). Need help?
Read the Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Ataxin-2 Antibody (NBP1-90063)
Discover more about diseases related to Ataxin-2 Antibody (NBP1-90063).
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Ataxin-2 Antibody and receive a gift card or discount.