Ataxin-2 Antibody

Images

 
Western Blot: Ataxin-2 Antibody [NBP1-90063] - Analysis in mouse cell line NIH-3T3.
Immunocytochemistry/ Immunofluorescence: Ataxin-2 Antibody [NBP1-90063] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90063] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
Western Blot: Ataxin-2 Antibody [NBP1-90063] - Analysis in human cell line K562.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ataxin-2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TPPAYSTQYVAYSPQQFPNQPLVQHVPHYQSQHPHVYSPVIQGNARMMAPPTHAQPGLVSSSATQYGAHEQTHAMYACPKLPYNKETSPSFYFAISTGSLAQQYAHPNATLHPHTPHPQPSATPTGQQQSQHGGSHPAPS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATXN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Ataxin-2 Protein (NBP1-90063PEP)
Publications
Read Publications using
NBP1-90063 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Ataxin-2 Antibody

  • ataxin 2
  • ataxin 2)
  • ataxin-2
  • ATX2spinocerebellar ataxia 2 (olivopontocerebellar ataxia 2, autosomal dominant
  • SCA2FLJ46772
  • Spinocerebellar ataxia type 2 protein
  • TNRC13
  • trinucleotide repeat containing 13
  • Trinucleotide repeat-containing gene 13 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32083
Species: Hu
Applications: WB, ICC/IF
NBP1-51689
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-38049
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-42657
Species: Hu
Applications: IP (-), WB
AF6567
Species: Hu, Mu
Applications: WB, IHC
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP1-90814
Species: Hu
Applications: IHC, IHC-P
NBP2-46667
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP2-14336
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00023435-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF1436
Species: Mu
Applications: WB
NBP2-13169
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
NBP2-56984
Species: Hu
Applications: ICC/IF
NBP2-49081
Species: Hu
Applications: WB, IHC
NB110-58346
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00006532-M06
Species: Hu
Applications: ELISA, IP

Publications for Ataxin-2 Antibody (NBP1-90063)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(2)
WB
(1)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for Ataxin-2 Antibody (NBP1-90063) (0)

There are no reviews for Ataxin-2 Antibody (NBP1-90063). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Ataxin-2 Antibody (NBP1-90063) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ataxin-2 Products

Bioinformatics Tool for Ataxin-2 Antibody (NBP1-90063)

Discover related pathways, diseases and genes to Ataxin-2 Antibody (NBP1-90063). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ataxin-2 Antibody (NBP1-90063)

Discover more about diseases related to Ataxin-2 Antibody (NBP1-90063).
 

Pathways for Ataxin-2 Antibody (NBP1-90063)

View related products by pathway.

PTMs for Ataxin-2 Antibody (NBP1-90063)

Learn more about PTMs related to Ataxin-2 Antibody (NBP1-90063).
 

Research Areas for Ataxin-2 Antibody (NBP1-90063)

Find related products by research area.

Blogs on Ataxin-2

There are no specific blogs for Ataxin-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ataxin-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATXN2