Ataxin-2 Antibody

Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90063] - Analysis in human testis and skeletal muscle tissues. Corresponding Ataxin-2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90063] - Staining of human cerebellum, cerebral cortex, skeletal muscle and testis using Anti-Ataxin-2 antibody NBP1-90063 (A) shows similar protein distribution across tissues to independent antibody NBP1-90062 (B).

Immunocytochemistry/Immunofluorescence: Ataxin-2 Antibody [NBP1-90063] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90063] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90063] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90063] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90063] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Western blot analysis in mouse cell line NIH-3T3.

Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1, using Anti-ATXN2 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Ataxin-2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TPPAYSTQYVAYSPQQFPNQPLVQHVPHYQSQHPHVYSPVIQGNARMMAPPTHAQPGLVSSSATQYGAHEQTHAMYACPKLPYNKETSPSFYFAISTGSLAQQYAHPNATLHPHTPHPQPSATPTGQQQSQHGGSHPAPS
• Predicted Species: Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATXN2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Please note that WB is no longer validated for the current lot of this antibody. The publications that cite use of this product in WB were for previous lots. The antibody may work in WB but we do not guarantee it any longer.
• Control Peptide:

  Ataxin-2 Protein (NBP1-90063PEP)

Reactivity Notes

Mouse reactivity reported in (PMID: 36288714).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Ataxin-2 Antibody

• ataxin 2
• ataxin 2)
• ataxin-2
• ATX2spinocerebellar ataxia 2 (olivopontocerebellar ataxia 2, autosomal dominant
• SCA2FLJ46772
• Spinocerebellar ataxia type 2 protein
• TNRC13
• trinucleotide repeat containing 13
• Trinucleotide repeat-containing gene 13 protein

Background

The autosomal dominant cerebellar ataxias (ADCA) are a heterogeneous group of neurodegenerative disorders characterized by progressive degeneration of the cerebellum, brain stem and spinal cord. Clinically, ADCA has been divided into three groups: ADCA types I-III. ADCAI is genetically heterogeneous, with five genetic loci, designated spinocerebellar ataxia (SCA) 1, 2, 3, 4 and 6, being assigned to five different chromosomes. ADCAII, which always presents with retinal degeneration (SCA7), and ADCAIII often referred to as the `pure' cerebellar syndrome (SCA5), are most likely homogeneous disorders. Several SCA genes have been cloned and shown to contain CAG repeats in their coding regions. ADCA is caused by the expansion of the CAG repeats, producing an elongated polyglutamine tract in the corresponding protein. The expanded repeats are variable in size and unstable, usually increasing in size when transmitted to successive generations. The function of the ataxins is not known. This locus has been mapped to chromosome 12, and it has been determined that the diseased allele contains 36-52 CAG repeats, compared to 22-23 in the normal allele. A potential transcript variant, missing an internal coding exon, has been described; however, its full-length nature is not certain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Ataxin-2 Antibody (NBP1-90063)(4)

Publications using NBP1-90063

• Rodriguez CM, Bechek SC, Jones GL et al. Targeting RTN4/NoGo-Receptor reduces levels of ALS protein ataxin-2 Cell reports 2022-10-25 [PMID: 36288715] (ICC/IF, WB, Human)
• Kim G, Nakayama L, Blum JA et al. Genome-wide CRISPR screen reveals v-ATPase as a drug target to lower levels of ALS protein ataxin-2 Cell reports 2022-10-25 [PMID: 36288714] (ICC/IF, Mouse)
  
  Details:
  Dilution used in ICC 1:1000
• Abraham KJ, Chan JN, Salvi JS et al. Intersection of calorie restriction and magnesium in the suppression of genome-destabilizing RNA-DNA hybrids Nucleic Acids Res. 2016-08-29 [PMID: 27574117] (ICC/IF, Human)
• Xia G, Santostefano K, Hamazaki T et al. Generation of Human-Induced Pluripotent Stem Cells to Model Spinocerebellar Ataxia Type 2 In vitro J Mol Neurosci 2012-12-09 [PMID: 23224816] (ICC/IF, WB, Human)

Bioinformatics

• Gene Symbol: ATXN2