We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

PADI2 Recombinant Protein Antigen

Images

 
There are currently no images for PADI2 Protein (NBP2-37918PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PADI2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PADI2.

Source: E. coli

Amino Acid Sequence: PWLPKEDCRDEKVYSKEDLKDMSQMILRTKGPDRLPAGYEIVLYISMSDSDKVGVFYVENPFFGQRYIHILGRRKLYHVVKYTGGS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PADI2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-37918.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PADI2 Recombinant Protein Antigen

  • EC 3.5.3.15
  • KIAA0994PDI2PAD2
  • PAD2
  • PAD-H19
  • PADI2
  • PDI2
  • peptidlyarginine deiminase type II
  • peptidyl arginine deiminase, type II
  • Peptidylarginine Deiminase II
  • protein arginine deiminase
  • Protein-arginine deiminase type II
  • protein-arginine deiminase type-2

Background

PADI2 / PAD2 is a member of the peptidyl arginine deiminase family of enzymes, which catalyze the post translational deimination of proteins by converting arginine residues into citrullines in the presence of calcium ions. Each family member has a distinct substrate specificity and tissue expression pattern. The type II enzyme is the most widely expressed family member. Known substrates for this enzyme include myelin basic protein in the central nervous system and vimentin in skeletal muscle and macrophages. This enzyme is thought to play a role in the onset and progression of neurodegenerative disorders, including Alzheimers disease and multiple sclerosis, and it has also been implicated in the pathogenesis of glaucoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02082
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-91834
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-37761
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-80956
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-92240
Species: Hu
Applications: ICC/IF, WB
NB600-717
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, RIA, RI, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
AF2307
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
NBP1-87528
Species: Hu
Applications: ICC/IF,  IHC-P
NBP3-04784
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF2439
Species: Mu
Applications: IHC, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
H00002729-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-31333
Species: Hu, Mu, Rb, Rt
Applications: WB
AF6016
Species: Hu, Mu
Applications: WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-37918PEP
Species: Hu
Applications: AC

Publications for PADI2 Protein (NBP2-37918PEP) (0)

There are no publications for PADI2 Protein (NBP2-37918PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PADI2 Protein (NBP2-37918PEP) (0)

There are no reviews for PADI2 Protein (NBP2-37918PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PADI2 Protein (NBP2-37918PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PADI2 Products

Research Areas for PADI2 Protein (NBP2-37918PEP)

Find related products by research area.

Blogs on PADI2

There are no specific blogs for PADI2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GFAP Antibody
NB300-141

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PADI2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PADI2