Recombinant Human PADI2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human PADI2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-108 of Human PADI2

Source: Wheat Germ

Amino Acid Sequence: MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSEHVWVEVVRDGEAEEVATNGKQRWLLSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSIPIDQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PADI2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
37.62 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PADI2 Protein

  • EC 3.5.3.15
  • KIAA0994PDI2PAD2
  • PAD2
  • PAD-H19
  • PADI2
  • PDI2
  • peptidlyarginine deiminase type II
  • peptidyl arginine deiminase, type II
  • Peptidylarginine Deiminase II
  • protein arginine deiminase
  • Protein-arginine deiminase type II
  • protein-arginine deiminase type-2

Background

PADI2 - peptidyl arginine deiminase, type II

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02082
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91834
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37761
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80956
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92240
Species: Hu
Applications: WB, IHC, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-22568
Species: Hu
Applications: IHC-P
NBP1-87527
Species: Hu
Applications: IHC, IHC-P
NBP1-88573
Species: Hu
Applications: WB, IHC, IHC-P
H00004340-B01P
Species: Hu, Rt
Applications: WB
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-31333
Species: Hu, Rt, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67074
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
H00011240-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for PADI2 Partial Recombinant Protein (H00011240-Q01) (0)

There are no publications for PADI2 Partial Recombinant Protein (H00011240-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PADI2 Partial Recombinant Protein (H00011240-Q01) (0)

There are no reviews for PADI2 Partial Recombinant Protein (H00011240-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PADI2 Partial Recombinant Protein (H00011240-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PADI2 Products

Bioinformatics Tool for PADI2 Partial Recombinant Protein (H00011240-Q01)

Discover related pathways, diseases and genes to PADI2 Partial Recombinant Protein (H00011240-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PADI2 Partial Recombinant Protein (H00011240-Q01)

Discover more about diseases related to PADI2 Partial Recombinant Protein (H00011240-Q01).
 

Pathways for PADI2 Partial Recombinant Protein (H00011240-Q01)

View related products by pathway.

PTMs for PADI2 Partial Recombinant Protein (H00011240-Q01)

Learn more about PTMs related to PADI2 Partial Recombinant Protein (H00011240-Q01).

Blogs on PADI2

There are no specific blogs for PADI2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PADI2 Antibody
NBP2-37918
GFAP Antibody
NB300-141

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PADI2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PADI2
Entrez