Independent Antibodies: Western Blot: Pescadillo Antibody [NBP2-55211] - Analysis using Anti-PES1 antibody NBP2-55211 (A) shows similar pattern to independent antibody NBP2-34146 (B).
Immunocytochemistry/ Immunofluorescence: Pescadillo Antibody [NBP2-55211] - Staining of human cell line U-2 OS shows localization to nucleoli. Antibody staining is shown in green.
beta ‐HB treatments decreased PES1‐facilitated VE‐cadherin ubiquitination in MVECs. (A–C) beta ‐HB increased the interaction between PES1 and VE‐cadherin. (D–G) Knockdown of Pes1 in cultured cells ...read more
KD improved vascular hyperpermeability and reduced vascular stiffness and leakage in type 2 diabetic mice. (A, B) The Evans blue injection and haematoxylin and eosin staining of abdominal aorta were performed for ...read more
Pes1 knockout in mice decreased vascular permeability. (A, B) The Evans blue injection and haematoxylin and eosin staining of abdominal aorta were conducted in different groups, original magnification, ×10 ...read more
beta ‐HB treatments decreased PES1‐facilitated VE‐cadherin ubiquitination in MVECs. (A–C) beta ‐HB increased the interaction between PES1 and VE‐cadherin. (D–G) Knockdown of Pes1 in cultured cells ...read more
beta ‐HB treatment reduced vascular endothelial paracellular permeability in vitro. (A, B) The protein levels of PES1, VEGF, VE‐cadherin, Ang‐1 and Occludin in MVECs were detected by immunoblotting after 2 mM ...read more
In vitro knockdown of Pes1 lowered the paracellular permeability of MVECs. (A, B) The protein levels of PES1, VEGF, VE‐cadherin, Ang‐1 and Occludin in MVECs were detected by immunoblotting after Pes1‐siRNA ...read more
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RMEGKKPRVMAGTLKLEDKQRLAQEEESEAKRLAIMMMKKREKYLYQKIMFGKRRKIREANKLAEKRKAHDE
Predicted Species
Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PES1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Pescadillo encodes a protein that is abnormally elevated in malignant tumors of astrocytic origin. It is a strongly conserved gene containing a BRCT domain that is essential for the activity of this gene product. The gene plays a crucial role in cell proliferation and may be necessary for oncogenic transformation and tumor progression.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Pescadillo Antibody - BSA Free and receive a gift card or discount.