Pescadillo Antibody

Images

 
Independent Antibodies: Western Blot: Pescadillo Antibody [NBP2-55211] - Analysis using Anti-PES1 antibody NBP2-55211 (A) shows similar pattern to independent antibody NBP2-34146 (B).
Immunocytochemistry/ Immunofluorescence: Pescadillo Antibody [NBP2-55211] - Staining of human cell line U-2 OS shows localization to nucleoli. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

Pescadillo Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RMEGKKPRVMAGTLKLEDKQRLAQEEESEAKRLAIMMMKKREKYLYQKIMFGKRRKIREANKLAEKRKAHDE
Specificity
Specificity of human Pescadillo antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PES1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Pescadillo Recombinant Protein Antigen (NBP2-55211PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Pescadillo Antibody

  • pescadillo homolog 1, containing BRCT domain (zebrafish)
  • pescadillo homolog
  • PESpescadillo (zebrafish) homolog 1, containing BRCT domain

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
NB300-517
Species: Hu, Mu, Rt, Po, Bv, Ha, Pm, Pm, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, B/N, KD
NBP2-37761
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-67068
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NBP2-01833
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP, S-ELISA
NBP2-53381
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr
NBL1-15012
Species: Hu
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49579
Species: Hu
Applications: IHC, IHC-P
NBP1-90266
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, KD
NBP2-26116
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-32005
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-55211
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for Pescadillo Antibody (NBP2-55211) (0)

There are no publications for Pescadillo Antibody (NBP2-55211).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pescadillo Antibody (NBP2-55211) (0)

There are no reviews for Pescadillo Antibody (NBP2-55211). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Pescadillo Antibody (NBP2-55211) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Pescadillo Products

Bioinformatics Tool for Pescadillo Antibody (NBP2-55211)

Discover related pathways, diseases and genes to Pescadillo Antibody (NBP2-55211). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pescadillo Antibody (NBP2-55211)

Discover more about diseases related to Pescadillo Antibody (NBP2-55211).
 

Pathways for Pescadillo Antibody (NBP2-55211)

View related products by pathway.

PTMs for Pescadillo Antibody (NBP2-55211)

Learn more about PTMs related to Pescadillo Antibody (NBP2-55211).
 

Research Areas for Pescadillo Antibody (NBP2-55211)

Find related products by research area.

Blogs on Pescadillo

There are no specific blogs for Pescadillo, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pescadillo Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PES1