Independent Antibodies: Western Blot: Pescadillo Antibody [NBP2-55211] - Analysis using Anti-PES1 antibody NBP2-55211 (A) shows similar pattern to independent antibody NBP2-34146 (B).
Immunocytochemistry/ Immunofluorescence: Pescadillo Antibody [NBP2-55211] - Staining of human cell line U-2 OS shows localization to nucleoli. Antibody staining is shown in green.
Novus Biologicals Rabbit Pescadillo Antibody - BSA Free (NBP2-55211) is a polyclonal antibody validated for use in WB and ICC/IF. Anti-Pescadillo Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RMEGKKPRVMAGTLKLEDKQRLAQEEESEAKRLAIMMMKKREKYLYQKIMFGKRRKIREANKLAEKRKAHDE
Predicted Species
Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PES1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Pescadillo encodes a protein that is abnormally elevated in malignant tumors of astrocytic origin. It is a strongly conserved gene containing a BRCT domain that is essential for the activity of this gene product. The gene plays a crucial role in cell proliferation and may be necessary for oncogenic transformation and tumor progression.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Pescadillo Antibody - BSA Free and receive a gift card or discount.