PA2G4/EBP1 Antibody

Images

 
Western Blot: EBP1 Antibody [NBP1-90369] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: EBP1 Antibody [NBP1-90369] - Staining of human duodenum shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PA2G4/EBP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVVDVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PA2G4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PA2G4/EBP1 Protein (NBP1-90369PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PA2G4/EBP1 Antibody

  • Cell cycle protein p38-2G4 homolog
  • EBP1
  • ErbB-3 binding protein 1
  • ErbB3-binding protein 1
  • ErbB3-binding protein Ebp1
  • HG4-1
  • p38-2G4
  • PA2G4
  • proliferation-associated 2G4, 38kD
  • proliferation-associated 2G4, 38kDa
  • proliferation-associated protein 2G4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3481
Species: Hu
Applications: Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB600-210
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1905
Species: Mu
Applications: WB
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84056
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88792
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-91214
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84382
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5629
Species: Hu, Mu
Applications: WB

Publications for PA2G4/EBP1 Antibody (NBP1-90369) (0)

There are no publications for PA2G4/EBP1 Antibody (NBP1-90369).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PA2G4/EBP1 Antibody (NBP1-90369) (0)

There are no reviews for PA2G4/EBP1 Antibody (NBP1-90369). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PA2G4/EBP1 Antibody (NBP1-90369) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PA2G4/EBP1 Products

Bioinformatics Tool for PA2G4/EBP1 Antibody (NBP1-90369)

Discover related pathways, diseases and genes to PA2G4/EBP1 Antibody (NBP1-90369). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PA2G4/EBP1 Antibody (NBP1-90369)

Discover more about diseases related to PA2G4/EBP1 Antibody (NBP1-90369).
 

Pathways for PA2G4/EBP1 Antibody (NBP1-90369)

View related products by pathway.

PTMs for PA2G4/EBP1 Antibody (NBP1-90369)

Learn more about PTMs related to PA2G4/EBP1 Antibody (NBP1-90369).
 

Research Areas for PA2G4/EBP1 Antibody (NBP1-90369)

Find related products by research area.

Blogs on PA2G4/EBP1

There are no specific blogs for PA2G4/EBP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PA2G4/EBP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PA2G4
Entrez