CRLF3 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: CRLF3 Antibody [NBP1-84382] - Staining in human lymph node and pancreas tissues using anti-CRLF3 antibody. Corresponding CRLF3 RNA-seq data are presented for ...read more
Genetic Strategies: Western Blot: CRLF3 Antibody [NBP1-84382] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading ...read more
Immunocytochemistry/ Immunofluorescence: CRLF3 Antibody [NBP1-84382] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
Western Blot: CRLF3 Antibody [NBP1-84382] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: CRLF3 Antibody [NBP1-84382] - Staining of human lymph node shows high expression.
Immunohistochemistry-Paraffin: CRLF3 Antibody [NBP1-84382] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CRLF3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IEHGVNTAEDLVREGEIAMLGGVGEENEKLWSFTKKASHIQLDSLPEVPLLVDVPCLSAQLDDSILNIVKDHIFKHGTVASRPPVQIEELIEKPGGIIVRWCKVDDDFTAQDYRLQFRKCTSNHFEDVYVGSE
Predicted Species
Mouse (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CRLF3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CRLF3 Protein (NBP1-84382PEP)

Reactivity Notes

Rat (89%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CRLF3 Antibody

  • CREME-9
  • CREME9MGC20661
  • cytokine receptor-like factor 3
  • Cytokine receptor-like molecule 9
  • Cytokine receptor-related protein 4
  • CYTOR4cytokine receptor related protein 4
  • FRWS
  • P48
  • p48.2
  • type I cytokine receptor like factor
  • Type I cytokine receptor-like factor p48

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16991
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-75930
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF2894
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
AF2890
Species: Hu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
NBP2-67330
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
285-IF
Species: Hu
Applications: BA
AF3297
Species: Hu
Applications: WB
H00010963-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NBP1-47842
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB500-207
Species: Hu
Applications: ICC/IF, IP, WB
H00008878-M01
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
DRT100
Species: Hu
Applications: ELISA
210-TA
Species: Hu
Applications: BA
NBP1-80905
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02148
Species: Hu
Applications: Flow, ICC/IF, WB
NB100-2559
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-33061
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NB400-141
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
NB500-212
Species: Hu
Applications: ICC/IF, IP, KD, WB
NBP2-45514
Species: Hu, Mu, Rt
Applications: IHC, WB

Publications for CRLF3 Antibody (NBP1-84382) (0)

There are no publications for CRLF3 Antibody (NBP1-84382).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRLF3 Antibody (NBP1-84382) (0)

There are no reviews for CRLF3 Antibody (NBP1-84382). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CRLF3 Antibody (NBP1-84382) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CRLF3 Products

Bioinformatics Tool for CRLF3 Antibody (NBP1-84382)

Discover related pathways, diseases and genes to CRLF3 Antibody (NBP1-84382). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRLF3 Antibody (NBP1-84382)

Discover more about diseases related to CRLF3 Antibody (NBP1-84382).
 

Pathways for CRLF3 Antibody (NBP1-84382)

View related products by pathway.

Research Areas for CRLF3 Antibody (NBP1-84382)

Find related products by research area.

Blogs on CRLF3

There are no specific blogs for CRLF3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CRLF3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CRLF3