Novus Biologicals products are now on bio-techne.com

p97/VCP Antibody

Images

 
Genetic Strategies: Western Blot: p97/VCP Antibody [NBP1-81620] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-VCP antibody. Remaining relative ...read more
Immunocytochemistry/ Immunofluorescence: p97/VCP Antibody [NBP1-81620] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: p97/VCP Antibody [NBP1-81620] - Staining of human hippocampus shows strong nuclear and cytoplasmic positivity in neuronal cells and glial cells.
Western Blot: p97/VCP Antibody [NBP1-81620] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

p97/VCP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VCP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
p97/VCP Protein (NBP1-81620PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for p97/VCP Antibody

  • 15S Mg(2+)-ATPase p97 subunit
  • IBMPFD
  • IBMPFDMGC8560
  • MGC131997
  • p97
  • TER ATPase
  • TERA
  • transitional endoplasmic reticulum ATPase
  • valosin containing protein
  • Valosin-containing proteinMGC148092
  • VCP
  • yeast Cdc48p homolog

Background

Valosin-containing protein (VCP or p97) belongs to the AAA (ATPase associated activities) family and acts as a molecular chaperone to a wide variety of cellular activities. Some of these activities include the alteration of both nuclear and mitotic golgi membranes, ubiquitin-proteasome dependent protein degradation, regulation of the NF-kappa b pathway, and extraction of membrane proteins. VCP has been shown to contain a substrate binding domain (N) and two conserved ATPase domains (D1 and D2). The three dimensional structure of VCP resembles that of a cylinder with the D1 and D2 stacked upon one another in a homo-hexameric ring formation. VCP is involved in the formation of neuronal inclusion bodies in neurodegenerative disease such as Parkinson's Disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1558
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
H00023435-M01
Species: Ba, Pp, Hu, I, Pm, Mu, Rt
Applications: ELISA, Func, ICC/IF, IHC, IHC-P, IP, KD, WB
H00008086-M02
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP2-61829
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-25162
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, PLA, WB
NBP2-13677
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-82166
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF5758
Species: Hu
Applications: ICC, IHC, WB
NB100-1343
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
MAB1904
Species: Hu
Applications: ICC, IHC, WB
NBP1-89163
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP3-25371
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89396
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87035
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00008878-M01
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Publications for p97/VCP Antibody (NBP1-81620) (0)

There are no publications for p97/VCP Antibody (NBP1-81620).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p97/VCP Antibody (NBP1-81620) (0)

There are no reviews for p97/VCP Antibody (NBP1-81620). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for p97/VCP Antibody (NBP1-81620) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional p97/VCP Products

Research Areas for p97/VCP Antibody (NBP1-81620)

Find related products by research area.

Blogs on p97/VCP

There are no specific blogs for p97/VCP, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our p97/VCP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VCP