Home » NPLOC4 » NPLOC4 Antibodies » NPLOC4 Antibody

NPLOC4 Antibody

 (2 Publications)
 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: NPLOC4 Antibody [NBP1-82166] - Analysis using Anti-NPLOC4 antibody NBP1-82166 (A) shows similar pattern to independent antibody NBP1-82165 (B).
Independent Antibodies: Western Blot: NPLOC4 Antibody [NBP1-82166] - Analysis using Anti-NPLOC4 antibody NBP1-82166 (A) shows similar pattern to independent antibody NBP1-82165 (B).
Immunocytochemistry/ Immunofluorescence: NPLOC4 Antibody [NBP1-82166] - Staining of human cell line A-431 shows positivity in nuclei but not nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NPLOC4 Antibody [NBP1-82166] - Staining of human esophagus shows moderate cytoplasmic and nuclear positivity in squamous epithelial cells.
Western Blot: NPLOC4 Antibody [NBP1-82166] - Analysis in human cell line A-549.
Western Blot: NPLOC4 Antibody [NBP1-82166] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Western Blot: NPLOC4 Antibody [NBP1-82166] - Whole cell lysate of PC12 using antibody against nuclear protein NPLOC4. Samples were run as triplicates. Image from verified customer review.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

        

Order Details

100% Guarantee on every product

NPLOC4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDVDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFSISQNPFPIENRDVLGETQDFHSLATYLSQNTSSVFLDTISDFHLLLFLVTNE
Specificity
Specificity of human NPLOC4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NPLOC4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
WB, ICC/IF reported in scientific literature (PMID: 29211715). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Reviewed Applications
Read 1 Review rated 5
using
NBP1-82166 in the following applications:
Publications
Read Publications using
NBP1-82166 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NPLOC4 Antibody

  • FLJ20657
  • FLJ23742
  • KIAA1499nuclear protein localization protein 4 homolog
  • NPL4Protein NPL4
  • nuclear protein localization 4 homolog (S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

UFD1L Antibody
(2A6F3)
NBP2-61829
Western Blot: UFD1L Antibody (2A6F3) [NBP2-61829] - Analysis using UFD1L mAb against HEK293 (1) and UFD1L (AA: 208-307)-hIgGFc transfected HEK293 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: UFD1L Antibody (2A6F3) [NBP2-61829] - Analysis of Hela cells using UFD1L mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin. Goat anti-Mouse IgG (H+L) DyLight 488 secondary antibody was used.
Immunohistochemistry-Paraffin: UFD1L Antibody (2A6F3) [NBP2-61829] - Analysis of endometrial cancer tissues using UFD1L mouse mAb with DAB staining.
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
p97/VCP Antibody
NB100-1558
Western Blot: p97/VCP Antibody [NB100-1558] - Detection of human VCP by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-VCP antibody NB100-1558 used for IP at 3 ug per reaction. VCP was also immunoprecipitated by rabbit anti-VCP antibody NB100-1557. For blotting immunoprecipitated VCP, NB100-1558 was used at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 1 second.
Western Blot: p97/VCP Antibody [NB100-1558] - Whole cell lysate (15 ug) from HeLa, 293T, Jurkat, mouse TCMK-1, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit antiVCP antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 1 second.
Western Blot: p97/VCP Antibody [NB100-1558] - Zymographic assay of gelatinase activity. Medium supernatants of 20?ml culture medium (medium control) as well as 20?ml conditioned medium from 107 U937 cells, pMTH1-U937 cells and asCD11b-U937 cells in the absence or presence of 5nM TPA for 72?h, respectively, were 18-fold concentrated and subjected to SDS-PAGE containing 2?mg/ml of gelatine. Following incubation with MMP enzyme buffer, the gels were stained with 0.4% Coomassie blue and afterwards destained again to visualize the appearance of gelatinase activity by light bands against the dark background. The molecular weight markers on both sides of the gels indicate the size of the MMPs exhibiting gelatinase activities. Image collected and cropped by CiteAb from the following publication (http://biosignaling.biomedcentral.com/articles/10.1186/1478-811X-10-13) licensed under a CC-BY licence.
(10 Publications)
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Gemin 4 Antibody
NB110-40591
Western Blot: Gemin 4 Antibody [NB110-40591] - Whole cell lysate from HeLa (5, 15 and 50 mcg for WB; 1 mg for IP, 20% of IP loaded) and 293T (T; 50 mcg) cells. NB110-40591 used for WB at 0.04 mcg/ml (A) and 1 mcg/ml (B) and used for IP at 3 mcg/mg lysate (B).
Immunohistochemistry-Paraffin: Gemin 4 Antibody [NB110-40591] - Human breast carcinoma. Antibody used at a dilution of 1:200.
Species: Hu
Applications: WB, IHC, IHC-P, IP
Craniofacial
Development Protein 1 ...
NBP2-43772
Western Blot: Craniofacial Development Protein 1 Antibody (11811) [NBP2-43772] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with CFDP1 antibody [11811].
Immunohistochemistry-Paraffin: Craniofacial Development Protein 1 Antibody (11811) [NBP2-43772] - Paraffin-embedded human ovarian cancer. CFDP1 stained by CFDP1 antibody [11811] diluted at 1:2000.
Western Blot: Craniofacial Development Protein 1 Antibody (11811) [NBP2-43772] - Analysis of A U87-MG whole cell lysate/extract B SK-N-SH whole cell lysate/extract C IMR32 whole cell lysate/extract D SK-N-AS whole cell lysate/extract 12 % SDS-PAGE CFDP1 antibody [11811] dilution: 1:1000
Species: Hu
Applications: WB, IHC, IHC-P
Proteasome 19S 10B
Antibody
NB100-1483
Western Blot: Proteasome 19S 10B Antibody [NB100-1483] - Staining of HeLa (A), U251 (B), KNRK (C) with antibody at 1 ug/mL and NIH3T3 (D) cell lysate with antibody at 0.3 ug/mL (35 ug protein in RIPA buffer). Detected by chemiluminescence.
Immunocytochemistry/Immunofluorescence: Proteasome 19S 10B Antibody [NB100-1483] - Immunofluorescence analysis of paraformaldehyde fixed HeLa cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing cytoplasmic and some nuclear staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
Flow Cytometry: Proteasome 19S 10B Antibody [NB100-1483] - Flow cytometric analysis of paraformaldehyde fixed HeLa cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, PEP-ELISA, PLA
DAP5 Antibody
(39C534.1)
NB120-11929
Western Blot: DAP5 Antibody (39C534.1) [NB120-11929] - Analysis of NB120-11929 (1ug) on 15 ug of total cell lysate from Jurkat cells.
Flow Cytometry: DAP5 Antibody (39C534.1) [NB120-11929] - Intracellular flow cytometric staining of 1 x 10^6 CHO (A) and HEK-293 (B) cells using antibody (dark blue). Isotype control shown in orange. An antibody concentration of 1 ug/1x10^6 cells was used.
(2 Publications)
Species: Hu, Mu
Applications: WB, Flow
NSFL1C Antibody
NBP2-13677
Western Blot: NSFL1C Antibody [NBP2-13677] - Analysis using Anti-NSFL1C antibody NBP2-13677 (A) shows similar pattern to independent antibody NBP2-13676 (B).
Immunocytochemistry/Immunofluorescence: NSFL1C Antibody [NBP2-13677] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13677] - Staining of human lymph node.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
ING1 Antibody
AF5758
Western blot shows lysates of A549 human lung carcinoma cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human ING1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5758) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for ING1 at approximately 28 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
ING1 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line using 10 µg/mL Goat Anti-Human ING1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5758) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red, upper panel; Catalog # NL001) and counterstained with DAPI (blue, lower panel). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
ING1 was detected in immersion fixed paraffin-embedded sections of human lung cancer tissue using 5 µg/mL Goat Anti-Human ING1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5758) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu
Applications: WB, IHC, ICC
PHF20 Antibody
NBP1-88309
Immunocytochemistry/Immunofluorescence: PHF20 Antibody [NBP1-88309] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & nuclear membrane.
Immunohistochemistry: PHF20 Antibody [NBP1-88309] - Staining of human esophagus shows strong nuclear membranous positivity in squamous epithelial cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
SCGF/CLEC11a
Antibody (239029) [Un ...
MAB1904
SCGF/CLEC11a was detected in immersion fixed IFN gamma activated THP-1 human acute monocytic leukemia cell line using 10 µg/mL Mouse Anti-Human SCGF/CLEC11a Monoclonal Antibody (Catalog # MAB1904) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counter­stained with DAPI (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
SCGF/CLEC11a was detected in immersion fixed paraffin-embedded sections of human spleen using 25 µg/mL Mouse Anti-Human SCGF/CLEC11a Monoclonal Antibody (Catalog # MAB1904) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Publication)
Species: Hu
Applications: WB, IHC, ICC
p97/VCP Antibody
NB100-1558
Western Blot: p97/VCP Antibody [NB100-1558] - Detection of human VCP by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-VCP antibody NB100-1558 used for IP at 3 ug per reaction. VCP was also immunoprecipitated by rabbit anti-VCP antibody NB100-1557. For blotting immunoprecipitated VCP, NB100-1558 was used at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 1 second.
Western Blot: p97/VCP Antibody [NB100-1558] - Whole cell lysate (15 ug) from HeLa, 293T, Jurkat, mouse TCMK-1, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit antiVCP antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 1 second.
Western Blot: p97/VCP Antibody [NB100-1558] - Zymographic assay of gelatinase activity. Medium supernatants of 20?ml culture medium (medium control) as well as 20?ml conditioned medium from 107 U937 cells, pMTH1-U937 cells and asCD11b-U937 cells in the absence or presence of 5nM TPA for 72?h, respectively, were 18-fold concentrated and subjected to SDS-PAGE containing 2?mg/ml of gelatine. Following incubation with MMP enzyme buffer, the gels were stained with 0.4% Coomassie blue and afterwards destained again to visualize the appearance of gelatinase activity by light bands against the dark background. The molecular weight markers on both sides of the gels indicate the size of the MMPs exhibiting gelatinase activities. Image collected and cropped by CiteAb from the following publication (http://biosignaling.biomedcentral.com/articles/10.1186/1478-811X-10-13) licensed under a CC-BY licence.
(10 Publications)
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
AKAP13 Antibody
NBP1-89163
Immunocytochemistry/Immunofluorescence: AKAP13 Antibody [NBP1-89163] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: AKAP13 Antibody [NBP1-89163] - Staining of human lymphoid tissues shows strong cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: AKAP13 Antibody [NBP1-89163] - Staining of human gallbladder shows cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Pleckstrin Antibody
NB100-1343
Western Blot: Pleckstrin Antibody [NB100-1343] - Staining of Human Parathyroid lysate (A) and negative control HepG2 (B) cell lysate (35ug protein in RIPA buffer). Antibody at 0.01 ug/mL. Detected by chemiluminescence.
Immunocytochemistry/Immunofluorescence: Pleckstrin Antibody [NB100-1343] - Analysis of paraformaldehyde fixed HeLa cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing cytoplasmic/membrane and nuclear staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
Immunohistochemistry-Paraffin: Pleckstrin Antibody [NB100-1343] - Staining of paraffin embedded Human Spleen. Antibody at 3.75 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(2 Publications)
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Dihydrolipoamide
Dehydrogenase/DLD Ant ...
NBP1-31302
Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with DLD antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - HeLa cells were fixed in ice-cold MeOH for 5 min. Green: DLD protein stained by DLD antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - Paraffin-embedded Gastric CA.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
ALDH9A1 Antibody
NBP1-89150
Western Blot: ALDH9A1 Antibody [NBP1-89150] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunohistochemistry-Paraffin: ALDH9A1 Antibody [NBP1-89150] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Western Blot: ALDH9A1 Antibody [NBP1-89150] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AMFR/gp78 Antibody
NBP2-15374
Western Blot: AMFR/gp78 Antibody [NBP2-15374] - Sample (30 ug of whole cell lysate) A: K562 7. 5% SDS PAGE; antibody diluted at 1:1000.
Immunohistochemistry-Paraffin: AMFR/gp78 Antibody [NBP2-15374] - Cal27 xenograft. AMFR antibody [N3C3] dilution: 1:500. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Immunohistochemistry-Paraffin: AMFR/gp78 Antibody [NBP2-15374] - Paraffin-embedded Hepatoma, using antibody at 1:500 dilution.
(2 Publications)
Species: Hu
Applications: WB, Func, IHC, IHC-P, In vitro
HRD1 Antibody
NB100-2526
Western Blot: HRD1 Antibody [NB100-2526] - Total protein from human HeLa, Hek293 and mouse 3T3 cell lines was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-HRD1 in block buffer and detected with an anti-rabbit HRP secondary antibody using West Pico PLUS chemiluminescence detection reagent.
Immunocytochemistry/Immunofluorescence: HRD1 Antibody [NB100-2526] - HRD1 antibody was tested in Hek293 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Immunohistochemistry-Paraffin: HRD1 Antibody [NB100-2526] - FFPE tissue section of human tonsil using rabbit polyclonal HRD1 antibody at 2 ug/mL concentration (1:500 dilution). The primary antibody binding to SYVN1/HRD1 antigen in cells was detected using HRP conjugated anti-Rabbit secondary antibody with DAB reagent, and the sections were further counterstained with hematoxylin for labeling cellular nuclei. This HRD1 antibody generated an expected cytoplasmic staining of HRD1 with stronger signal around periphery of the nucleus signifying the staining of the endoplasmic reticulum.
(2 Reviews)
(11 Publications)
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IHC, IHC-P, KO
NPLOC4 Antibody
NBP1-82166
NPLOC4 Antibody
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NPLOC4 Antibody (NBP1-82166)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for NPLOC4 Antibody (NBP1-82166) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Rat.

Reviews using NBP1-82166:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Rat
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot NPLOC4 NBP1-82166
Enlarge
reviewed by:
Luiz Alexandre Magno
 WB Rat 10/17/2018
View

Summary

ApplicationWestern Blot
Sample TestedPC12 cell lysate
SpeciesRat
LotA96635

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NPLOC4 Antibody (NBP1-82166) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional NPLOC4 Products

Bioinformatics Tool for NPLOC4 Antibody (NBP1-82166)

Discover related pathways, diseases and genes to NPLOC4 Antibody (NBP1-82166). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NPLOC4 Antibody (NBP1-82166)

Discover more about diseases related to NPLOC4 Antibody (NBP1-82166).
 

Pathways for NPLOC4 Antibody (NBP1-82166)

View related products by pathway.

PTMs for NPLOC4 Antibody (NBP1-82166)

Learn more about PTMs related to NPLOC4 Antibody (NBP1-82166).

Blogs on NPLOC4

There are no specific blogs for NPLOC4, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0
Western Blot NPLOC4 NBP1-82166
Enlarge
 Luiz Alexandre Magno
10/17/2018
Application: WB
Species: Rat
read this review

Bioinformatics

Gene Symbol NPLOC4
Novus 100% Guarantee