NPLOC4 Antibody

Images

 
Independent Antibodies: Western Blot: NPLOC4 Antibody [NBP1-82166] - Analysis using Anti-NPLOC4 antibody NBP1-82166 (A) shows similar pattern to independent antibody NBP1-82165 (B).
Immunocytochemistry/ Immunofluorescence: NPLOC4 Antibody [NBP1-82166] - Staining of human cell line A-431 shows positivity in nuclei but not nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NPLOC4 Antibody [NBP1-82166] - Staining of human esophagus shows moderate cytoplasmic and nuclear positivity in squamous epithelial cells.
Western Blot: NPLOC4 Antibody [NBP1-82166] - Analysis in human cell line A-549.
Western Blot: NPLOC4 Antibody [NBP1-82166] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Western Blot: NPLOC4 Antibody [NBP1-82166] - Whole cell lysate of PC12 using antibody against nuclear protein NPLOC4. Samples were run as triplicates. Image from verified customer review.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

NPLOC4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDVDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFSISQNPFPIENRDVLGETQDFHSLATYLSQNTSSVFLDTISDFHLLLFLVTNE
Specificity
Specificity of human NPLOC4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NPLOC4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
WB, ICC/IF reported in scientific literature (PMID: 29211715). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Reviewed Applications
Read 1 Review rated 5
using
NBP1-82166 in the following applications:

Publications
Read Publications using
NBP1-82166 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NPLOC4 Antibody

  • FLJ20657
  • FLJ23742
  • KIAA1499nuclear protein localization protein 4 homolog
  • NPL4Protein NPL4
  • nuclear protein localization 4 homolog (S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61829
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-1558
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB110-40591
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-43772
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1483
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, PEP-ELISA, PLA
NB120-11929
Species: Hu, Mu
Applications: WB, Flow
NBP2-13677
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5758
Species: Hu
Applications: WB, IHC, ICC
NBP1-88309
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1904
Species: Hu
Applications: WB, IHC, ICC
NB100-1558
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-89163
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1343
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-15374
Species: Hu
Applications: WB, Func, IHC, IHC-P, In vitro
NB100-2526
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP1-82166
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NPLOC4 Antibody (NBP1-82166)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for NPLOC4 Antibody (NBP1-82166) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Rat.

Reviews using NBP1-82166:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Rat
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot NPLOC4 NBP1-82166
Enlarge
reviewed by:
Luiz Alexandre Magno
WB Rat 10/17/2018
View

Summary

ApplicationWestern Blot
Sample TestedPC12 cell lysate
SpeciesRat
LotA96635

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NPLOC4 Antibody (NBP1-82166) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NPLOC4 Products

Bioinformatics Tool for NPLOC4 Antibody (NBP1-82166)

Discover related pathways, diseases and genes to NPLOC4 Antibody (NBP1-82166). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NPLOC4 Antibody (NBP1-82166)

Discover more about diseases related to NPLOC4 Antibody (NBP1-82166).
 

Pathways for NPLOC4 Antibody (NBP1-82166)

View related products by pathway.

PTMs for NPLOC4 Antibody (NBP1-82166)

Learn more about PTMs related to NPLOC4 Antibody (NBP1-82166).

Blogs on NPLOC4

There are no specific blogs for NPLOC4, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Luiz Alexandre Magno
10/17/2018
Application: WB
Species: Rat

Bioinformatics

Gene Symbol NPLOC4
Novus 100% Guarantee