NPLOC4 Antibody

Western Blot: NPLOC4 Antibody [NBP1-82166] - Analysis using Anti-NPLOC4 antibody NBP1-82166 (A) shows similar pattern to independent antibody NBP1-82165 (B).

Immunocytochemistry/Immunofluorescence: NPLOC4 Antibody [NBP1-82166] - Staining of human cell line A-431 shows positivity in nuclei but not nucleoli. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: NPLOC4 Antibody [NBP1-82166] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Western Blot: NPLOC4 Antibody [NBP1-82166] - Analysis in human cell line A-549.

Western Blot: NPLOC4 Antibody [NBP1-82166] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Western Blot: NPLOC4 Antibody [NBP1-82166] - Whole cell lysate of PC12 using antibody against nuclear protein NPLOC4. Samples were run as triplicates. Image from verified customer review.

Immunohistochemistry-Paraffin: NPLOC4 Antibody [NBP1-82166] - Staining of human placenta shows moderate granular cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: NPLOC4 Antibody [NBP1-82166] - Staining of human skeletal muscle shows moderate to strong cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: NPLOC4 Antibody [NBP1-82166] - Staining of human skin shows weak to moderate cytoplasmic positivity in squamous epithelial cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

NPLOC4 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDVDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFSISQNPFPIENRDVLGETQDFHSLATYLSQNTSSVFLDTISDFHLLLFLVTNE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NPLOC4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB, ICC/IF reported in scientific literature (PMID: 29211715). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NPLOC4 Protein (NBP1-82166PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NPLOC4 Antibody

• FLJ20657
• FLJ23742
• KIAA1499nuclear protein localization protein 4 homolog
• NPL4Protein NPL4
• nuclear protein localization 4 homolog (S. cerevisiae)

Background

The ternary complex containing UFD1L, VCP and NPLOC4 binds ubiquitinated proteins and is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome. The NPLOC4-UFD1L-VCP complex regulates spindle disassembly at the end of mitosis and is necessary for the formation of a closed nuclear envelope

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NPLOC4 Antibody (NBP1-82166)(5)

Publications using NBP1-82166

• Chroma K, Skrott Z, Gursky J et al. A drug repurposing strategy for overcoming human multiple myeloma resistance to standard-of-care treatment Cell death & disease 2022-03-04 [PMID: 35246527] (WB, Human)
• Serra R, Zhao T, Huq S Et al. Disulfiram and copper combination therapy targets NPL4, cancer stem cells and extends survival in a medulloblastoma model PloS one 2021-11-03 [PMID: 34731160] (ICC/IF, IHC-P, WB, Human)
• Skrott Z, Mistrik M, Andersen KK et al. Alcohol-abuse drug disulfiram targets cancer via p97 segregase adaptor NPL4. Nature 2017-12-14 [PMID: 29211715] (ICC/IF, WB, Human)
• Davis EJ, Lachaud C, Appleton P et al. DVC1 (C1orf124) recruits the p97 protein segregase to sites of DNA damage. Nat Struct Mol Biol 2012-11-01 [PMID: 23042607]
• Zhang H, Wang T, Liu H et al. Boost therapy of hepatocellular carcinoma by amplifying vicious cycle between mitochondrial oxidative stress and endoplasmic reticulum stress via biodegradable ultrasmall nanoparticles and old drug Nano Today 2022-10-01 (ICC/IF, WB, Human)
  
  Details:
  ICC/If Dilution: 1:200; WB Dilution: 1:1000

Review for NPLOC4 Antibody (NBP1-82166) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Rat.

reviewed by: Verified Customer WB Rat 10/17/2018

Summary

• Application: Western Blot
• Sample Tested: PC12 cell lysate
• Species: Rat
• Lot: A96635

Bioinformatics

• Gene Symbol: NPLOC4