| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: EEEEGQRFYAGGSERSGQQIVGPPRKKSPNELVDDLFKGAKEHGAVAVERVTKSPGETSKPRPFAGGGYRLG |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NSFL1C |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publications using NBP2-13677 | Applications | Species |
|---|---|---|
| Mirsanaye A, Hoffmann S, Weisser M et al. VCF1 is an unconventional p97/VCP cofactor promoting recognition of ubiquitylated p97-UFD1-NPL4 substrates bioRxiv 2023-07-26 (IP) Details: 0.5 µg/sample |
IP | |
| Shearer RF, Typas D, Coscia F et al. K27-linked ubiquitylation promotes p97 substrate processing and is essential for cell proliferation The EMBO journal 2022-05-02 [PMID: 35349166] (WB, ICC/IF, Human) | WB, ICC/IF | Human |
| Wang K Z Q, Steer E et al. PINK1 Interacts with VCP/p97 and Activates PKA to Promote NSFL1C/p47 Phosphorylation and Dendritic Arborization in Neurons. Eneuro 2019-02-21 [PMID: 30783609] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NSFL1C |