NSFL1C Antibody


Independent Antibodies: Western Blot: NSFL1C Antibody [NBP2-13677] - Analysis using Anti-NSFL1C antibody NBP2-13677 (A) shows similar pattern to independent antibody NBP2-13676 (B).
Immunocytochemistry/ Immunofluorescence: NSFL1C Antibody [NBP2-13677] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13677] - Staining of human lymph node.
Independent Antibodies: Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13677] - Staining of human cerebral cortex, kidney, lymph node and testis using Anti-NSFL1C antibody NBP2-13677 (A) shows similar ...read more
Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13677] - Staining of human kidney.
Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13677] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13677] - Staining of human testis.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Independent Antibodies


Order Details

NSFL1C Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: EEEEGQRFYAGGSERSGQQIVGPPRKKSPNELVDDLFKGAKEHGAVAVER VTKSPGETSKPRPFAGGGYRLG
Specificity of human NSFL1C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NSFL1C Protein (NBP2-13677PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for NSFL1C Antibody

  • dJ776F14.1
  • NSFL1 (p97) cofactor (p47)
  • NSFL1 cofactor p47
  • p47
  • p97 cofactor p47
  • SHP1 homolog
  • UBX domain protein 2C
  • UBX domain-containing protein 2C
  • UBX1
  • UBXD10
  • UBXN2CMGC3347


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Ba
Applications: WB, Flow, IHC, IHC-P, IP, PEP-ELISA, IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NSFL1C Antibody (NBP2-13677) (0)

There are no publications for NSFL1C Antibody (NBP2-13677).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NSFL1C Antibody (NBP2-13677) (0)

There are no reviews for NSFL1C Antibody (NBP2-13677). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NSFL1C Antibody (NBP2-13677) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional NSFL1C Products

Bioinformatics Tool for NSFL1C Antibody (NBP2-13677)

Discover related pathways, diseases and genes to NSFL1C Antibody (NBP2-13677). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NSFL1C Antibody (NBP2-13677)

Discover more about diseases related to NSFL1C Antibody (NBP2-13677).

Pathways for NSFL1C Antibody (NBP2-13677)

View related products by pathway.

Blogs on NSFL1C

There are no specific blogs for NSFL1C, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NSFL1C Antibody and receive a gift card or discount.


Gene Symbol NSFL1C