NSFL1C Antibody

Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13677] - Staining of human cerebral cortex, kidney, lymph node and testis using Anti-NSFL1C antibody NBP2-13677 (A) shows similar protein distribution across tissues to independent antibody NBP2-13676 (B).

Western Blot: NSFL1C Antibody [NBP2-13677] - Analysis using Anti-NSFL1C antibody NBP2-13677 (A) shows similar pattern to independent antibody NBP2-13676 (B).

Western Blot: NSFL1C Antibody [NBP2-13677] - PINK1 phosphorylates the activation loop of PKA. Immunoprecipitation products of HEK293 cell lysates expressing GFP or PINK1-GFP reveal that PINK1 pulls down the PKA holoenzyme (PKAcat and PKAreg) in addition to VCP and NSFL1C. Image collected and cropped by CiteAb from the following publication (//eneuro.org/lookup/doi/10.1523/ENEURO.0466-18.2018), licensed under a CC-BY license.

Immunocytochemistry/Immunofluorescence: NSFL1C Antibody [NBP2-13677] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13677] - Staining of human testis.

Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13677] - Staining of human kidney.

Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13677] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13677] - Staining of human lymph node.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

NSFL1C Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: EEEEGQRFYAGGSERSGQQIVGPPRKKSPNELVDDLFKGAKEHGAVAVERVTKSPGETSKPRPFAGGGYRLG
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NSFL1C
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NSFL1C Protein (NBP2-13677PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NSFL1C Antibody

• dJ776F14.1
• NSFL1 (p97) cofactor (p47)
• NSFL1 cofactor p47
• p47
• p97 cofactor p47
• SHP1 homolog
• UBX domain protein 2C
• UBX domain-containing protein 2C
• UBX1
• UBXD10
• UBXN2CMGC3347

Background

N-ethylmaleimide-sensitive factor (NSF) and valosin-containing protein (p97) are two ATPases known to be involved in transport vesicle/target membrane fusion and fusions between membrane compartments. A trimer of the protein encoded by this gene binds a hexamer of cytosolic p97 and is required for p97-mediated regrowth of Golgi cisternae from mitotic Golgi fragments. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NSFL1C Antibody (NBP2-13677)(3)

Publications using NBP2-13677

• Mirsanaye A, Hoffmann S, Weisser M et al. VCF1 is an unconventional p97/VCP cofactor promoting recognition of ubiquitylated p97-UFD1-NPL4 substrates bioRxiv 2023-07-26 (IP)
  
  Details:
  0.5 µg/sample
• Shearer RF, Typas D, Coscia F et al. K27-linked ubiquitylation promotes p97 substrate processing and is essential for cell proliferation The EMBO journal 2022-05-02 [PMID: 35349166] (WB, ICC/IF, Human)
• Wang K Z Q, Steer E et al. PINK1 Interacts with VCP/p97 and Activates PKA to Promote NSFL1C/p47 Phosphorylation and Dendritic Arborization in Neurons. Eneuro 2019-02-21 [PMID: 30783609] (WB, Human)

Bioinformatics

• Gene Symbol: NSFL1C