p63/TP73L Recombinant Protein Antigen

Images

 
There are currently no images for p63/TP73L Recombinant Protein Antigen (NBP3-05501PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

p63/TP73L Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human p63/TP73L.

Source: E. coli

Amino Acid Sequence: CACPGRDRKADEDSIRKQQVSDSTKNGDAFRQNTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKESLELMQYLPQHTIETYRQQQQQQHQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TP63
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-05501.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for p63/TP73L Recombinant Protein Antigen

  • amplified in squamous cell carcinoma
  • Chronic ulcerative stomatitis protein
  • CUSP
  • EEC3
  • EEC3B(p51B)
  • Keratinocyte transcription factor KET
  • KET
  • KETRHS
  • LMS
  • OFC8
  • OFC8SHFM4TP73LNBP
  • p40
  • p51
  • p51tumor protein p53-like
  • p53CP
  • p63
  • p63AIS
  • p73H
  • p73L
  • p73LB(p51A)
  • SHFM4
  • TP53CP
  • TP53L
  • TP63
  • TP73L
  • Transformation-related protein 63
  • tumor protein 63
  • tumor protein p53-competing protein
  • tumor protein p63 deltaN isoform delta
  • tumor protein p63
  • Tumor protein p73-like

Background

The p63 gene, a homologue of the tumor suppressor p53, is highly expressed in the basal or progenitor layers of many epithelial tissues. P63 shows remarkable structural similarity to p53 and to the related p73 gene. Unlike p53, the p63 gene encodes multiple isotypes with remarkably divergent abilities to transactivate p53 reporter genes and induce apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF7355
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-24737
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP1-84161
Species: Hu
Applications: IHC,  IHC-P
1290-IL
Species: Hu
Applications: BA
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
DY417
Species: Mu
Applications: ELISA
NBP3-13279
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
419-ML
Species: Mu
Applications: BA
AF3770
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
2428-FC
Species: Hu
Applications: Bind
NBP1-91931
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89530
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-92564
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-34270
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western
NBP2-61931
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-05501PEP
Species: Hu
Applications: AC

Publications for p63/TP73L Recombinant Protein Antigen (NBP3-05501PEP) (0)

There are no publications for p63/TP73L Recombinant Protein Antigen (NBP3-05501PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p63/TP73L Recombinant Protein Antigen (NBP3-05501PEP) (0)

There are no reviews for p63/TP73L Recombinant Protein Antigen (NBP3-05501PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for p63/TP73L Recombinant Protein Antigen (NBP3-05501PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional p63/TP73L Products

Research Areas for p63/TP73L Recombinant Protein Antigen (NBP3-05501PEP)

Find related products by research area.

Blogs on p63/TP73L.

Spheroids vs. Organoids: Which 3D Cell Culture Model is Best for You?
By Jennifer Jones, M.S.Spheroids and organoids are two words that, like “butter” and “margarine”, are often referred to interchangeably but have distinct meanings. The progression and adopt...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our p63/TP73L Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TP63