P2Y12/P2RY12 was detected in immersion fixed paraffin-embedded sections of human Cortex using Rabbit Anti-human P2Y12/P2RY12, Polyclonal Antibody (Catalog # NBP2-33870) at 1:100 at 37°Celsius for 4 minutes. Before ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870] - Staining in human cerebral cortex and liver tissues . Corresponding P2RY12 RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870] - Staining of human cerebral cortex shows strong cytoplasmic positivity in microglia.
Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870] - Staining of human liver shows no positivity as expected.
Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.
Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870] - Staining of human cerebellum shows strong cytoplasmic positivity in microglia.
Immunohistochemistry-Frozen: P2Y12/P2RY12 Antibody [NBP2-33870] - Canine optic nerve. Immunofluorescent signal was detected using Alexa Fluor 488 conjugated secondary antibody (green). IHC-Fr image submitted by a ...read more
Immunohistochemistry: P2Y12/P2RY12 Antibody [NBP2-33870] - Images demonstrating colocalization of CD105/MAB1097 with microglial markers (a) panels A, B Low magnification images of high-plaque (HP) case (panel A) & AD ...read more
Quantitative biochemical measurements of P2RY12 protein and mRNA in human brains. (A–C). Western blot measurements of P2RY12 levels in MTG samples from LP, HP and AD brains. (A). Representative western blot image of ...read more
Novus Biologicals Rabbit P2Y12/P2RY12 Antibody - BSA Free (NBP2-33870) is a polyclonal antibody validated for use in Multiplex Immunofluorescence, IHC, WB, ICC/IF and Simple Western. Anti-P2Y12/P2RY12 Antibody: Cited in 12 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
P2RY12
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Feline, Canine reactivity reported from verified customer reviews.
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for P2Y12/P2RY12 Antibody - BSA Free
ADPG-R
Gi-coupled ADP receptor HORK3
HORK3
HORK3P2Y12 platelet ADP receptor
P2RY12
P2T(AC)
P2Y purinoceptor 12
P2Y(AC)
P2Y(ADP)
P2Y(cyc)
P2Y12
P2Y12ADP-glucose receptor
purinergic receptor P2RY12
purinergic receptor P2Y, G-protein coupled, 12
putative G-protein coupled receptor
SP1999
SP1999G-protein coupled receptor SP1999
Background
P2Y12 is a Purinergic Receptor essential for the aggregation of blood platelets. There is evidence that mutations in P2Y12 cause a bleeding disorder, suggesting that knowledge of the P2Y12 receptor could advance the development of antiplatelet agents to treat cardiovascular diseases. Expression of P2Y12 has been reported in platelets, spinal cord, and many brain regions. ESTs for P2Y12 have been isolated from B-cell/lung/testis, brain, embryo, prostate, eye, kidney carcinoma, and colon carcinoma libraries. Cognate
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Li C, Liu K, Zhu J, Zhu F The effects of high plasma levels of A beta 1-42 on mononuclear macrophage in mouse models of Alzheimer's disease Research Square 2022-12-07 (IHC, Mouse)
Walker D, Tang T, Takeuchi S et al. Immunophenotyping of Microglia In Alzheimers Disease Brains: Comparison of Expression of Progranulin and Purinergic Receptor P2Ry12 Alzheimer's & Dementia 2018-07-01 (IF/IHC, Human)
Free floating coronal sections 50um. 72 hr primary @ RT with 4hr secondary @ RT. ***Bio-Techne Response: This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.***
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.