OXCT1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: OXCT1 Antibody [NBP2-49331] - Immunofluorescent staining of human cell line SiHa shows localization to mitochondria.
Immunohistochemistry-Paraffin: OXCT1 Antibody [NBP2-49331] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Orthogonal Strategies: Immunohistochemistry-Paraffin: OXCT1 Antibody [NBP2-49331] - Analysis in human heart muscle and liver tissues. Corresponding OXCT1 RNA-seq data are presented for the same tissues.
Independent Antibodies: Immunohistochemistry-Paraffin: OXCT1 Antibody [NBP2-49331] - Staining of human heart muscle, kidney, liver and testis using Anti-OXCT1 antibody NBP2-49331 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: OXCT1 Antibody [NBP2-49331] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: OXCT1 Antibody [NBP2-49331] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: OXCT1 Antibody [NBP2-49331] - Staining of human liver shows no positivity in hepatocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OXCT1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ATWYKGCVCSFSTSAHRHTKFYTDPVEAVKDIPDGA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OXCT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
OXCT1 Recombinant Protein Antigen (NBP2-49331PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for OXCT1 Antibody

  • 3-oxoacid CoA transferase 1,3-oxoacid CoA transferase
  • EC 2.8.3
  • EC 2.8.3.5
  • SCOTmitochondrial

Background

OXCT1 encodes a member of the 3-oxoacid CoA-transferase gene family. The encoded protein is a homodimeric mitochondrial matrix enzyme that plays a central role in extrahepatic ketone body catabolism by catalyzing the reversible transfer of coenzyme A from succinyl-CoA to acetoacetate. Mutations in this gene are associated with succinyl CoA:3-oxoacid CoA transferase deficiency. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP3-03109
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-60655
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89284
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, KD, WB
664-LI/CF
Species: Hu
Applications: BA
NBP2-38861
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3844
Species: Hu, Mu
Applications: IHC
NBP1-88673
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB400-141
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
NBP2-33908
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
1073-BP/CF
Species: Hu
Applications: Bind
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-32109
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-53791
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
AF009
Species: Hu
Applications: IHC, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
AF1073
Species: Hu
Applications: IHC, WB
NLS272
Species: Ha, Hu, Pm, Mu, Rb, Rt
Applications: IHC, IHC-Fr, IHC-P

Publications for OXCT1 Antibody (NBP2-49331) (0)

There are no publications for OXCT1 Antibody (NBP2-49331).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OXCT1 Antibody (NBP2-49331) (0)

There are no reviews for OXCT1 Antibody (NBP2-49331). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for OXCT1 Antibody (NBP2-49331) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OXCT1 Products

Bioinformatics Tool for OXCT1 Antibody (NBP2-49331)

Discover related pathways, diseases and genes to OXCT1 Antibody (NBP2-49331). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OXCT1 Antibody (NBP2-49331)

Discover more about diseases related to OXCT1 Antibody (NBP2-49331).
 

Pathways for OXCT1 Antibody (NBP2-49331)

View related products by pathway.

PTMs for OXCT1 Antibody (NBP2-49331)

Learn more about PTMs related to OXCT1 Antibody (NBP2-49331).
 

Research Areas for OXCT1 Antibody (NBP2-49331)

Find related products by research area.

Blogs on OXCT1

There are no specific blogs for OXCT1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OXCT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OXCT1