Recombinant Human OVGP1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human OVGP1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 579 - 677 of Human OVGP1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RNISVTPEGQTMPLRGENLTSEVGTHPRMGNLGLQMEAENRMMLSSSPVIQLPEQTPLAFDNRFVPIYGNHSSVNSVTPQTSPLSLKKEIPENSAVDEE

Protein/Peptide Type
Partial Recombinant Protein
Gene
OVGP1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human OVGP1 Protein

  • CHIT5
  • EGP
  • Estrogen-dependent oviduct protein
  • MUC9
  • mucin 9
  • mucin-9
  • OGP
  • oviduct glycoprotein
  • oviductal glycoprotein 1, 120kDa
  • Oviductal glycoprotein
  • oviductin
  • oviduct-specific glycoprotein

Background

This gene encodes a large, carbohydrate-rich, epithelial glycoprotein with numerous O-glycosylation sites located within threonine, serine, and proline-rich tandem repeats. The gene is similar to members of the mucin and the glycosyl hydrolase 18 gene families. Regulation of expression may be estrogen-dependent. Gene expression and protein secretion occur during late follicular development through early cleavage-stage embryonic development. The protein is secreted from non-ciliated oviductal epithelial cells and associates with ovulated oocytes, blastomeres, and spermatozoan acrosomal regions. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-80533
Species: Mu
Applications: WB
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1182
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-30830
Species: Hu
Applications: IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-44374
Species: Hu
Applications: Flow, IHC-P, IF
NBP2-15196
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for OVGP1 Partial Recombinant Protein (H00005016-Q01) (0)

There are no publications for OVGP1 Partial Recombinant Protein (H00005016-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OVGP1 Partial Recombinant Protein (H00005016-Q01) (0)

There are no reviews for OVGP1 Partial Recombinant Protein (H00005016-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OVGP1 Partial Recombinant Protein (H00005016-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional OVGP1 Products

Bioinformatics Tool for OVGP1 Partial Recombinant Protein (H00005016-Q01)

Discover related pathways, diseases and genes to OVGP1 Partial Recombinant Protein (H00005016-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OVGP1 Partial Recombinant Protein (H00005016-Q01)

Discover more about diseases related to OVGP1 Partial Recombinant Protein (H00005016-Q01).
 

Pathways for OVGP1 Partial Recombinant Protein (H00005016-Q01)

View related products by pathway.

PTMs for OVGP1 Partial Recombinant Protein (H00005016-Q01)

Learn more about PTMs related to OVGP1 Partial Recombinant Protein (H00005016-Q01).

Blogs on OVGP1

There are no specific blogs for OVGP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

OVGP1 Antibody
NBP1-76939

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human OVGP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol OVGP1