OTUD7B/Cezanne/ZA20D1 Antibody

Images

 
Western Blot: OTUD7B/Cezanne/ZA20D1 Antibody [NBP1-88095] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: OTUD7B/Cezanne/ZA20D1 Antibody [NBP1-88095] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & microtubules.
Immunohistochemistry-Paraffin: OTUD7B/Cezanne/ZA20D1 Antibody [NBP1-88095] - Staining of human rectum shows strong cytoplasmic and nuclear positivity in glandular cells.
Western Blot: OTUD7B/Cezanne/ZA20D1 Antibody [NBP1-88095] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-406

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OTUD7B/Cezanne/ZA20D1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PHQDSIPSLEPGSHSKDGLHRGALLPPPYRVADSYSNGYREPPEPDGWAGGLRGLPPTQTKCKQPNCSFYG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OTUD7B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
OTUD7B/Cezanne/ZA20D1 Protein (NBP1-88095PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for OTUD7B/Cezanne/ZA20D1 Antibody

  • cellular zinc finger NF-kappaB Cezanne
  • Cellular zinc finger NF-kappa-B protein
  • Cezanne
  • CEZANNEA20 domain containing 1
  • EC 3.4.19.12
  • OTU domain containing 7B
  • OTU domain-containing protein 7B
  • OTUD7B
  • ZA20D1
  • Zinc finger A20 domain-containing protein 1
  • Zinc finger protein Cezanne

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77533
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P, IP, CyTOF-ready
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-270
Species: Hu, Mu, Rt, Ch
Applications: WB, Simple Western, ICC/IF, IP, In vitro
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32367
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-02293
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34106
Species: Hu
Applications: IHC, IHC-P
NBP1-89926
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
796-IC
Species: Mu
NLS272
Species: Hu, Mu, Rt, Ha, Mk, Rb
Applications: IHC-P
NBP1-01469
Species: Hu
Applications: WB, PEP-ELISA
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for OTUD7B/Cezanne/ZA20D1 Antibody (NBP1-88095) (0)

There are no publications for OTUD7B/Cezanne/ZA20D1 Antibody (NBP1-88095).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OTUD7B/Cezanne/ZA20D1 Antibody (NBP1-88095) (0)

There are no reviews for OTUD7B/Cezanne/ZA20D1 Antibody (NBP1-88095). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for OTUD7B/Cezanne/ZA20D1 Antibody (NBP1-88095) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OTUD7B/Cezanne/ZA20D1 Products

Bioinformatics Tool for OTUD7B/Cezanne/ZA20D1 Antibody (NBP1-88095)

Discover related pathways, diseases and genes to OTUD7B/Cezanne/ZA20D1 Antibody (NBP1-88095). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OTUD7B/Cezanne/ZA20D1 Antibody (NBP1-88095)

Discover more about diseases related to OTUD7B/Cezanne/ZA20D1 Antibody (NBP1-88095).
 

Pathways for OTUD7B/Cezanne/ZA20D1 Antibody (NBP1-88095)

View related products by pathway.

PTMs for OTUD7B/Cezanne/ZA20D1 Antibody (NBP1-88095)

Learn more about PTMs related to OTUD7B/Cezanne/ZA20D1 Antibody (NBP1-88095).
 

Research Areas for OTUD7B/Cezanne/ZA20D1 Antibody (NBP1-88095)

Find related products by research area.

Blogs on OTUD7B/Cezanne/ZA20D1

There are no specific blogs for OTUD7B/Cezanne/ZA20D1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OTUD7B/Cezanne/ZA20D1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OTUD7B
Entrez