OSER1 Antibody

Images

 
Western Blot: OSER1 Antibody [NBP1-91725] - Analysis in control (vector only transfected HEK293T lysate) and OSER1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: OSER1 Antibody [NBP1-91725] - Staining of human cell line A-431 shows localization to nucleoli & nuclear speckles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: OSER1 Antibody [NBP1-91725] - Staining of human kidney shows moderate cytoplasmic and nuclear positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OSER1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GKPCTCIGKECQCKRWHDMEVYSFSGLQSVPPLAPERRSTLEDYSQSLHARTLSGSPRSCSEQARVFVDDVTIEDLSGYMEYYLYIPKKMS
Predicted Species
Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C20ORF111
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
OSER1 Recombinant Protein Antigen (NBP1-91725PEP)
Publications
Read Publication using
NBP1-91725 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for OSER1 Antibody

  • chromosome 20 open reading frame 111
  • dJ1183I21.1
  • HSPC207
  • Osr1
  • oxidative stress responsive 1
  • Perit1
  • peroxide-inducible transcript 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-48021
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-44270
Species: Mu, Rt
Applications: EM, ICC/IF, IHC, IHC-P, WB
NB600-284
Species: Hu, Mu, Rt
Applications: EM, ICC/IF (-), IHC, IHC-Fr, IHC-P, IP, WB
AF2849
Species: Mu, Rt
Applications: WB
NB100-75623
Species: Bv, Ca, Hu, Mu, Pm, Rt
Applications: IHC, WB
NBP1-87833
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-80993
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00009943-M16
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP2-56333
Species: Hu
Applications: ICC/IF, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP2-93100
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
AF3364
Species: Hu
Applications: ICC, IHC, WB
MAB25031
Species: Hu
Applications: IHC, IP, WB
NB110-60011
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
H00010736-M01
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP2-15658
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-86893
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-82874
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-00764
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-91725
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for OSER1 Antibody (NBP1-91725)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for OSER1 Antibody (NBP1-91725) (0)

There are no reviews for OSER1 Antibody (NBP1-91725). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for OSER1 Antibody (NBP1-91725) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OSER1 Products

Bioinformatics Tool for OSER1 Antibody (NBP1-91725)

Discover related pathways, diseases and genes to OSER1 Antibody (NBP1-91725). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on OSER1

There are no specific blogs for OSER1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OSER1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C20ORF111