![Immunocytochemistry/Immunofluorescence: OSER1 Antibody [NBP1-91725] - Staining of human cell line A-431 shows localization to nucleoli & nuclear speckles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/C20orf111-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-91725-img0005.jpg "Immunocytochemistry/Immunofluorescence: OSER1 Antibody [NBP1-91725] - Staining of human cell line A-431 shows localization to nucleoli & nuclear speckles. Antibody staining is shown in green.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit OSER1 Antibody - BSA Free (NBP1-91725) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-OSER1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GKPCTCIGKECQCKRWHDMEVYSFSGLQSVPPLAPERRSTLEDYSQSLHARTLSGSPRSCSEQARVFVDDVTIEDLSGYMEYYLYIPKKMS |
| Predicted Species | Mouse (92%), Rat (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | OSER1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP1-91725 | Applications | Species |
|---|---|---|
| Xu Y, Chen Y et al. TargetLink, a new method for identifying the endogenous target set of a specific microRNA in intact living cells. RNA Biol 2017-01-02 [PMID: 27982722] (ICC/IF, WB, Human) | ICC/IF, WB | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | OSER1 |
![Immunohistochemistry-Paraffin: OSER1 Antibody [NBP1-91725] - Staining of human kidney shows moderate cytoplasmic and nuclear positivity in cells in tubules.](http://images.novusbio.com/fullsize/C20orf111-Antibody-Immunohistochemistry-Paraffin-NBP1-91725-img0002.jpg "Immunohistochemistry-Paraffin: OSER1 Antibody [NBP1-91725] - Staining of human kidney shows moderate cytoplasmic and nuclear positivity in cells in tubules.")
![Western Blot WNK1 Antibody [Unconjugated]](https://images.novusbio.com/images2/WNK1_AF2849_Western_Blot_5218.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Immunocytochemistry Pax2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax2_AF3364_Immunocytochemistry_14405.jpg)
![Western Blot Pax2 Antibody [Unconjugated]](https://images.novusbio.com/images2/af3364_human-pax2-affinity-purified-polyclonal-ab-western-blot-145202183852.jpg)
![Immunohistochemistry Pax2 Antibody [Unconjugated]](https://images.novusbio.com/images2/af3364_human-pax2-affinity-purified-polyclonal-ab-immunohistochemistry-192021142455.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_6973.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_9671.jpg)
![Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images/mab25031_human-cftr-c-terminus-mab-clone-24-1-41202412513815.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")