Recombinant Human ORP150/HSP12A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ORP150/HSP12A Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 36-147 of Human HYOU1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNPKATLRYFQHLLGKQADNPHVALYQARFPEHELTFDPQRQTVHFQISSQLQFSPL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
HYOU1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ORP150/HSP12A Protein

  • 150 kDa oxygen-regulated protein
  • 170 kDa glucose-regulated protein
  • DKFZp686N08236
  • FLJ97572
  • glucose-regulated protein 170
  • Grp170
  • GRP-170
  • HSP12A
  • HYOU1
  • hypoxia up-regulated 1
  • hypoxia up-regulated protein 1
  • ORP150
  • ORP-150
  • ORP150FLJ94899
  • oxygen regulated protein (150kD)

Background

HYOU1( AAH04560, 36 a.a. - 148 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NB300-619
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1543
Species: Hu
Applications: WB, IHC
AF4029
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-84796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-02459
Species: Hu, Mu, Rt, Ch, Dr, Pm
Applications: WB, ELISA, IHC, IHC-P
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-40256
Species: Hu, Mu, Rt, Fi, Ha, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-01652
Species: Hu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-45970
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IF
NBP2-02377
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
H00010525-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for ORP150/HSP12A Recombinant Protein (H00010525-P01) (0)

There are no publications for ORP150/HSP12A Recombinant Protein (H00010525-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ORP150/HSP12A Recombinant Protein (H00010525-P01) (0)

There are no reviews for ORP150/HSP12A Recombinant Protein (H00010525-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ORP150/HSP12A Recombinant Protein (H00010525-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ORP150/HSP12A Products

Bioinformatics Tool for ORP150/HSP12A Recombinant Protein (H00010525-P01)

Discover related pathways, diseases and genes to ORP150/HSP12A Recombinant Protein (H00010525-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ORP150/HSP12A Recombinant Protein (H00010525-P01)

Discover more about diseases related to ORP150/HSP12A Recombinant Protein (H00010525-P01).
 

Pathways for ORP150/HSP12A Recombinant Protein (H00010525-P01)

View related products by pathway.

PTMs for ORP150/HSP12A Recombinant Protein (H00010525-P01)

Learn more about PTMs related to ORP150/HSP12A Recombinant Protein (H00010525-P01).
 

Research Areas for ORP150/HSP12A Recombinant Protein (H00010525-P01)

Find related products by research area.

Blogs on ORP150/HSP12A

There are no specific blogs for ORP150/HSP12A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ATF6 Antibody (70B1413.1)
NBP1-40256-0.1mg

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ORP150/HSP12A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HYOU1
Entrez